F223754

General Info

Members Datasets Scaffolds Average Seq Length
156 84 156 189

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10000828|rootH1_100008283
Length 212
Sequence MRVKYSFAGRTWQIHVARPHHRPMALRIVHYNDPVLRKKGEPVKVFDAALALLSDQMLATMNTAAGIGLAAQQIGRALQFCVVDLRQTDRDFAWELDGATPPLELFMPLSLANPVVKVLPSEKTVYEEGCLSFPHIRGDVIRPDAIEVTYQDIQGASHTLRCDGLLARCIQHEVDHLNGTLFIDRMEKKVRGGIEKDIKELAKKTREESEGV

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
13 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
14 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
15 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
16 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
17 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
18 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
19 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
30 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
31 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
32 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
33 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
34 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
35 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
36 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
37 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
38 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
39 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
40 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
41 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
42 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
43 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
44 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
45 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
46 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
47 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
48 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
49 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
50 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
51 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
52 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
53 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
54 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
55 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
59 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
60 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
61 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
62 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
63 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
64 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
65 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
66 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
67 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
68 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
71 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
72 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
73 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
74 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
79 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
80 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
81 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
82 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
83 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0.64
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 96.79
Stem 0
Stem Tuber 0
Unclassified 3.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10001325 3300003320 Bacteria 14623
2 rootL2_10051374 3300003322 Bacteria 5465
3 rootH1_10000828 3300003323 Bacteria 5619
4 rootH1_10170609 3300003323 Bacteria 2398
5 rootH1_10180704 3300003323 Bacteria 2085
6 Ga0070683_100001399 3300005329 Bacteria 18515
7 Ga0068869_100000005 3300005334 Bacteria 103764
8 Ga0068868_100015534 3300005338 Bacteria 5634
9 Ga0070713_100002257 3300005436 Bacteria 12512
10 Ga0068867_100000853 3300005459 Bacteria 20577
11 Ga0070679_100015546 3300005530 Bacteria 7313
12 Ga0068857_100563247 3300005577 Unclassified 1074
13 Ga0068856_100019312 3300005614 Bacteria 6616
14 Ga0068856_100024770 3300005614 Bacteria 5845
15 Ga0070717_10060285 3300006028 Bacteria 3142
16 Ga0097621_100003103 3300006237 Bacteria 11393
17 Ga0068871_100006845 3300006358 Bacteria 8114
18 Ga0157369_10164391 3300013105 Bacteria 2341
19 Ga0163163_10090355 3300014325 Unclassified 3075
20 Ga0157379_10668594 3300014968 Bacteria 973
21 Ga0157376_10062719 3300014969 Bacteria 3128
22 Ga0207693_10955059 3300025915 Unclassified 656
23 Ga0207652_10010882 3300025921 Bacteria 7332
24 Ga0207700_10021321 3300025928 Bacteria 4422
25 Ga0207689_10000629 3300025942 Bacteria 33613
26 Ga0207661_10055413 3300025944 Bacteria 3180
27 Ga0207677_10016305 3300026023 Bacteria 4395
28 Ga0207702_10001374 3300026078 Bacteria 24256
29 Ga0207702_10249859 3300026078 Unclassified 1665
30 Ga0207648_10005750 3300026089 Bacteria 12430
31 Ga0207674_10585040 3300026116 Unclassified 1078
32 Ga0207683_10377997 3300026121 Bacteria 1302
33 Ga0265337_1002878 3300028556 Bacteria 7676
34 Ga0265337_1005267 3300028556 Bacteria 5166
35 Ga0265337_1007330 3300028556 Bacteria 4135
36 Ga0265337_1023436 3300028556 Bacteria 1899
37 Ga0265337_1031448 3300028556 Bacteria 1577
38 Ga0265326_10036180 3300028558 Bacteria 1404
39 Ga0265319_1000755 3300028563 Bacteria 21072
40 Ga0265319_1002076 3300028563 Bacteria 11238
41 Ga0265319_1002267 3300028563 Bacteria 10638
42 Ga0265319_1002919 3300028563 Bacteria 9118
43 Ga0265319_1009847 3300028563 Bacteria 4033
44 Ga0265319_1030100 3300028563 Bacteria 1901
45 Ga0265334_10148216 3300028573 Bacteria 828
46 Ga0265318_10000406 3300028577 Bacteria 33364
47 Ga0265318_10001890 3300028577 Bacteria 11742
48 Ga0265318_10002888 3300028577 Bacteria 8946
49 Ga0265318_10009255 3300028577 Bacteria 4344
50 Ga0265318_10024031 3300028577 Unclassified 2423
51 Ga0265318_10081147 3300028577 Bacteria 1198
52 Ga0265323_10000063 3300028653 Bacteria 58892
53 Ga0265323_10026558 3300028653 Bacteria 2182
54 Ga0265322_10000081 3300028654 Bacteria 45549
55 Ga0265322_10005097 3300028654 Bacteria 3887
56 Ga0265322_10021346 3300028654 Bacteria 1855
57 Ga0265322_10057795 3300028654 Bacteria 1100
58 Ga0265338_10000407 3300028800 Bacteria 77238
59 Ga0265338_10010492 3300028800 Bacteria 10849
60 Ga0265338_10087397 3300028800 Unclassified 2590
61 Ga0265338_10389917 3300028800 Bacteria 995
62 Ga0265324_10000052 3300029957 Bacteria 97159
63 Ga0265324_10000587 3300029957 Bacteria 24898
64 Ga0265324_10023952 3300029957 Unclassified 2172
65 Ga0265324_10029247 3300029957 Bacteria 1938
66 Ga0265332_10008591 3300031238 Bacteria 4588
67 Ga0265332_10116591 3300031238 Bacteria 1123
68 Ga0265332_10135818 3300031238 Bacteria 1031
69 Ga0265328_10027001 3300031239 Bacteria 2155
70 Ga0265328_10027735 3300031239 Unclassified 2121
71 Ga0265320_10000771 3300031240 Bacteria 24529
72 Ga0265320_10001682 3300031240 Bacteria 15726
73 Ga0265320_10004266 3300031240 Bacteria 9395
74 Ga0265320_10006353 3300031240 Bacteria 7452
75 Ga0265320_10008465 3300031240 Bacteria 6296
76 Ga0265320_10014825 3300031240 Bacteria 4421
77 Ga0265320_10163395 3300031240 Bacteria 1002
78 Ga0265320_10223508 3300031240 Bacteria 838
79 Ga0265325_10025043 3300031241 Bacteria 3241
80 Ga0265325_10032904 3300031241 Bacteria 2766
81 Ga0265340_10018927 3300031247 Bacteria 3548
82 Ga0265340_10147590 3300031247 Unclassified 1073
83 Ga0265339_10322838 3300031249 Bacteria 732
84 Ga0265331_10002435 3300031250 Bacteria 12607
85 Ga0265331_10006999 3300031250 Bacteria 6584
86 Ga0265327_10000092 3300031251 Bacteria 195619
87 Ga0265327_10068791 3300031251 Bacteria 1779
88 Ga0265327_10074002 3300031251 Bacteria 1698
89 Ga0265316_10000676 3300031344 Bacteria 37951
90 Ga0265316_10008848 3300031344 Bacteria 9298
91 Ga0265316_10012377 3300031344 Bacteria 7655
92 Ga0265316_10016063 3300031344 Bacteria 6513
93 Ga0265316_10033590 3300031344 Bacteria 4176
94 Ga0265316_10040391 3300031344 Bacteria 3740
95 Ga0265316_10114409 3300031344 Bacteria 2041
96 Ga0307408_100000007 3300031548 Bacteria 463086
97 Ga0265313_10000706 3300031595 Bacteria 34509
98 Ga0265313_10001138 3300031595 Bacteria 25416
99 Ga0265313_10002081 3300031595 Bacteria 17894
100 Ga0265313_10003407 3300031595 Bacteria 12886
101 Ga0265314_10007112 3300031711 Bacteria 9757
102 Ga0265314_10062984 3300031711 Bacteria 2518
103 Ga0265314_10281412 3300031711 Bacteria 941
104 Ga0265342_10004395 3300031712 Bacteria 11124
105 Ga0265342_10006621 3300031712 Bacteria 8601
106 Ga0265342_10033587 3300031712 Bacteria 3153
107 Ga0265342_10046055 3300031712 Bacteria 2622
108 Ga0265342_10119790 3300031712 Bacteria 1483
109 Ga0265342_10193841 3300031712 Bacteria 1108
110 Ga0307405_10124063 3300031731 Bacteria 1773
111 Ga0307413_10511909 3300031824 Bacteria 966
112 Ga0307410_10001288 3300031852 Bacteria 11170
113 Ga0307407_10018494 3300031903 Bacteria 3525
114 Ga0307412_10021428 3300031911 Bacteria 3948
115 Ga0307409_100000061 3300031995 Bacteria 39679
116 Ga0307416_100000073 3300032002 Bacteria 80676
117 Ga0373939_0102827 3300035114 Bacteria 983
118 Ga0373937_0233115 3300036401 Bacteria 1734
119 Ga0395905_0000016 3300037471 Bacteria 382308
120 Ga0439431_0034531 3300041997 Bacteria 1268
121 Ga0451577_0000327 3300042876 Bacteria 88625
122 Ga0451577_0001860 3300042876 Bacteria 26905
123 Ga0466972_0104743 3300044658 Bacteria 1338
124 Ga0453683_0002931 3300044673 Bacteria 12865
125 Ga0453684_0007932 3300044712 Bacteria 19257
126 Ga0453684_0077672 3300044712 Bacteria 4159
127 Ga0453684_0154084 3300044712 Bacteria 2727
128 Ga0453684_0159403 3300044712 Bacteria 2671
129 Ga0453684_0295313 3300044712 Bacteria 1843
130 Ga0453684_0647096 3300044712 Bacteria 1154
131 Ga0466970_0005831 3300044765 Bacteria 6130
132 Ga0466959_0126563 3300045049 Bacteria 1813
133 Ga0451576_0000146 3300045051 Bacteria 179707
134 Ga0451576_0001618 3300045051 Bacteria 37793
135 Ga0451576_0078756 3300045051 Bacteria 3429
136 Ga0451576_0479748 3300045051 Bacteria 1306
137 Ga0451576_0496174 3300045051 Unclassified 1282
138 Ga0451576_1050748 3300045051 Bacteria 853
139 Ga0466967_0251010 3300045976 Bacteria 1690
140 Ga0495631_0065374 3300046518 Bacteria 1574
141 Ga0495637_0000001 3300046520 Bacteria 820224
142 Ga0495597_0115514 3300046542 Bacteria 1122
143 Ga0495661_0000002 3300046665 Bacteria 823350
144 Ga0501034_0123191 3300049571 Bacteria 2578
145 Ga0501038_0478252 3300049574 Bacteria 955
146 Ga0501046_0000009 3300049580 Bacteria 335813
147 Ga0501047_0873815 3300049581 Bacteria 713
148 Ga0501227_014133 3300049665 Bacteria 1768
149 Ga0501243_000474 3300049675 Bacteria 5343
150 Ga0501083_0002600 3300049744 Bacteria 12431
151 Ga0501269_021866 3300049766 Bacteria 800
152 Ga0501044_0002898 3300049823 Bacteria 19536
153 Ga0501044_0402624 3300049823 Bacteria 1281
154 Ga0587109_041652 3300059624 Unclassified 913
155 Ga0501082_0050981 3300060353 Bacteria 3568
156 Ga0501082_0410447 3300060353 Bacteria 1182

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049574 Ga0501038_0478252 Ga0501038_0478252_20_502 151
2 3300060353 Ga0501082_0410447 Ga0501082_0410447_13_495 151
3 3300031251 Ga0265327_10074002 Ga0265327_100740022 163
4 3300029957 Ga0265324_10000052 Ga0265324_1000005231 164
5 3300035114 Ga0373939_0102827 Ga0373939_0102827_153_674 164
6 3300044658 Ga0466972_0104743 Ga0466972_0104743_613_1134 164
7 3300044765 Ga0466970_0005831 Ga0466970_0005831_949_1470 164
8 3300049581 Ga0501047_0873815 Ga0501047_0873815_93_614 164
9 3300049823 Ga0501044_0402624 Ga0501044_0402624_22_543 164
10 3300059624 Ga0587109_041652 Ga0587109_041652_318_839 164
11 3300060353 Ga0501082_0050981 Ga0501082_0050981_327_848 164
12 3300046518 Ga0495631_0065374 Ga0495631_0065374_376_912 165
13 3300046520 Ga0495637_0000001 Ga0495637_0000001_112906_113505 165
14 3300046542 Ga0495597_0115514 Ga0495597_0115514_235_771 165
15 3300046665 Ga0495661_0000002 Ga0495661_0000002_705486_706022 165
16 3300049571 Ga0501034_0123191 Ga0501034_0123191_1635_2171 168
17 3300049580 Ga0501046_0000009 Ga0501046_0000009_67960_68508 169
18 3300031251 Ga0265327_10000092 Ga0265327_10000092135 171
19 3300031251 Ga0265327_10068791 Ga0265327_100687912 172
20 3300031240 Ga0265320_10004266 Ga0265320_100042665 173
21 3300005577 Ga0068857_100563247 Ga0068857_1005632472 178
22 3300005614 Ga0068856_100019312 Ga0068856_1000193125 178
23 3300026078 Ga0207702_10001374 Ga0207702_100013748 178
24 3300026116 Ga0207674_10585040 Ga0207674_105850402 178
25 3300042876 Ga0451577_0001860 Ga0451577_0001860_4511_5071 178
26 3300044712 Ga0453684_0159403 Ga0453684_0159403_288_851 178
27 3300044712 Ga0453684_0295313 Ga0453684_0295313_277_837 178
28 3300049665 Ga0501227_014133 Ga0501227_014133_782_1345 179
29 3300003322 rootL2_10051374 rootL2_100513743 180
30 3300003323 rootH1_10170609 rootH1_101706092 180
31 3300005329 Ga0070683_100001399 Ga0070683_10000139913 180
32 3300005614 Ga0068856_100024770 Ga0068856_1000247705 180
33 3300006028 Ga0070717_10060285 Ga0070717_100602853 180
34 3300013105 Ga0157369_10164391 Ga0157369_101643912 180
35 3300014325 Ga0163163_10090355 Ga0163163_100903552 180
36 3300025944 Ga0207661_10055413 Ga0207661_100554132 180
37 3300026078 Ga0207702_10249859 Ga0207702_102498592 180
38 3300028800 Ga0265338_10389917 Ga0265338_103899172 180
39 3300031240 Ga0265320_10163395 Ga0265320_101633951 180
40 3300042876 Ga0451577_0000327 Ga0451577_0000327_71661_72227 180
41 3300044673 Ga0453683_0002931 Ga0453683_0002931_9071_9640 180
42 3300044712 Ga0453684_0077672 Ga0453684_0077672_3345_3911 180
43 3300045051 Ga0451576_0078756 Ga0451576_0078756_2339_2905 180
44 3300045051 Ga0451576_0479748 Ga0451576_0479748_31_600 180
45 3300045051 Ga0451576_0496174 Ga0451576_0496174_405_974 180
46 3300045051 Ga0451576_1050748 Ga0451576_1050748_211_780 180
47 3300003323 rootH1_10000828 rootH1_100008283 181
48 3300005334 Ga0068869_100000005 Ga0068869_10000000521 181
49 3300005338 Ga0068868_100015534 Ga0068868_1000155343 181
50 3300005459 Ga0068867_100000853 Ga0068867_1000008537 181
51 3300006237 Ga0097621_100003103 Ga0097621_1000031039 181
52 3300006358 Ga0068871_100006845 Ga0068871_1000068456 181
53 3300014968 Ga0157379_10668594 Ga0157379_106685941 181
54 3300025942 Ga0207689_10000629 Ga0207689_1000062921 181
55 3300026023 Ga0207677_10016305 Ga0207677_100163054 181
56 3300026089 Ga0207648_10005750 Ga0207648_100057506 181
57 3300028556 Ga0265337_1002878 Ga0265337_10028788 181
58 3300028563 Ga0265319_1009847 Ga0265319_10098472 181
59 3300028563 Ga0265319_1030100 Ga0265319_10301002 181
60 3300028577 Ga0265318_10081147 Ga0265318_100811472 181
61 3300031240 Ga0265320_10014825 Ga0265320_100148253 181
62 3300031250 Ga0265331_10006999 Ga0265331_100069992 181
63 3300031824 Ga0307413_10511909 Ga0307413_105119091 181
64 3300044712 Ga0453684_0007932 Ga0453684_0007932_1177_1749 181
65 3300045049 Ga0466959_0126563 Ga0466959_0126563_759_1331 181
66 3300049766 Ga0501269_021866 Ga0501269_021866_55_627 181
67 3300049823 Ga0501044_0002898 Ga0501044_0002898_2712_3284 181
68 3300028556 Ga0265337_1007330 Ga0265337_10073304 182
69 3300028563 Ga0265319_1002076 Ga0265319_10020763 182
70 3300028577 Ga0265318_10002888 Ga0265318_100028882 182
71 3300028577 Ga0265318_10024031 Ga0265318_100240312 182
72 3300028653 Ga0265323_10000063 Ga0265323_1000006315 182
73 3300028653 Ga0265323_10026558 Ga0265323_100265582 182
74 3300028654 Ga0265322_10000081 Ga0265322_1000008114 182
75 3300028654 Ga0265322_10005097 Ga0265322_100050972 182
76 3300028654 Ga0265322_10021346 Ga0265322_100213462 182
77 3300028654 Ga0265322_10057795 Ga0265322_100577951 182
78 3300028800 Ga0265338_10010492 Ga0265338_100104926 182
79 3300029957 Ga0265324_10000587 Ga0265324_100005876 182
80 3300029957 Ga0265324_10023952 Ga0265324_100239522 182
81 3300031238 Ga0265332_10116591 Ga0265332_101165912 182
82 3300031238 Ga0265332_10135818 Ga0265332_101358181 182
83 3300031239 Ga0265328_10027735 Ga0265328_100277352 182
84 3300031240 Ga0265320_10001682 Ga0265320_100016826 182
85 3300031240 Ga0265320_10008465 Ga0265320_100084657 182
86 3300031241 Ga0265325_10032904 Ga0265325_100329043 182
87 3300031247 Ga0265340_10147590 Ga0265340_101475902 182
88 3300031249 Ga0265339_10322838 Ga0265339_103228381 182
89 3300031344 Ga0265316_10000676 Ga0265316_1000067610 182
90 3300031344 Ga0265316_10008848 Ga0265316_100088483 182
91 3300031344 Ga0265316_10012377 Ga0265316_100123776 182
92 3300031595 Ga0265313_10002081 Ga0265313_100020818 182
93 3300031595 Ga0265313_10003407 Ga0265313_1000340711 182
94 3300031711 Ga0265314_10007112 Ga0265314_100071127 182
95 3300031711 Ga0265314_10062984 Ga0265314_100629842 182
96 3300031712 Ga0265342_10004395 Ga0265342_100043957 182
97 3300031712 Ga0265342_10046055 Ga0265342_100460551 182
98 3300031712 Ga0265342_10193841 Ga0265342_101938411 182
99 3300036401 Ga0373937_0233115 Ga0373937_0233115_663_1238 182
100 3300037471 Ga0395905_0000016 Ga0395905_0000016_358048_358620 182
101 3300044712 Ga0453684_0647096 Ga0453684_0647096_437_1012 182
102 3300045976 Ga0466967_0251010 Ga0466967_0251010_821_1393 182
103 3300005436 Ga0070713_100002257 Ga0070713_1000022577 183
104 3300005530 Ga0070679_100015546 Ga0070679_1000155463 183
105 3300025915 Ga0207693_10955059 Ga0207693_109550591 183
106 3300025921 Ga0207652_10010882 Ga0207652_100108824 183
107 3300025928 Ga0207700_10021321 Ga0207700_100213214 183
108 3300028556 Ga0265337_1005267 Ga0265337_10052673 183
109 3300028556 Ga0265337_1023436 Ga0265337_10234361 183
110 3300028556 Ga0265337_1031448 Ga0265337_10314481 183
111 3300028558 Ga0265326_10036180 Ga0265326_100361802 183
112 3300028563 Ga0265319_1000755 Ga0265319_10007558 183
113 3300028563 Ga0265319_1002267 Ga0265319_10022674 183
114 3300028563 Ga0265319_1002919 Ga0265319_100291910 183
115 3300028573 Ga0265334_10148216 Ga0265334_101482162 183
116 3300028577 Ga0265318_10000406 Ga0265318_1000040617 183
117 3300028577 Ga0265318_10001890 Ga0265318_100018907 183
118 3300028577 Ga0265318_10009255 Ga0265318_100092552 183
119 3300028800 Ga0265338_10000407 Ga0265338_1000040747 183
120 3300028800 Ga0265338_10087397 Ga0265338_100873972 183
121 3300029957 Ga0265324_10029247 Ga0265324_100292472 183
122 3300031238 Ga0265332_10008591 Ga0265332_100085913 183
123 3300031239 Ga0265328_10027001 Ga0265328_100270013 183
124 3300031240 Ga0265320_10000771 Ga0265320_100007718 183
125 3300031240 Ga0265320_10006353 Ga0265320_100063537 183
126 3300031241 Ga0265325_10025043 Ga0265325_100250431 183
127 3300031247 Ga0265340_10018927 Ga0265340_100189272 183
128 3300031250 Ga0265331_10002435 Ga0265331_1000243512 183
129 3300031344 Ga0265316_10016063 Ga0265316_100160633 183
130 3300031344 Ga0265316_10033590 Ga0265316_100335902 183
131 3300031344 Ga0265316_10040391 Ga0265316_100403914 183
132 3300031344 Ga0265316_10114409 Ga0265316_101144092 183
133 3300031595 Ga0265313_10000706 Ga0265313_1000070621 183
134 3300031595 Ga0265313_10001138 Ga0265313_100011385 183
135 3300031711 Ga0265314_10281412 Ga0265314_102814122 183
136 3300031712 Ga0265342_10006621 Ga0265342_100066215 183
137 3300031712 Ga0265342_10033587 Ga0265342_100335871 183
138 3300031712 Ga0265342_10119790 Ga0265342_101197902 183
139 3300044712 Ga0453684_0154084 Ga0453684_0154084_798_1466 183
140 3300049675 Ga0501243_000474 Ga0501243_000474_3777_4352 183
141 3300003320 rootH2_10001325 rootH2_100013259 184
142 3300003323 rootH1_10180704 rootH1_101807042 184
143 3300014969 Ga0157376_10062719 Ga0157376_100627194 184
144 3300026121 Ga0207683_10377997 Ga0207683_103779972 184
145 3300031240 Ga0265320_10223508 Ga0265320_102235082 184
146 3300031548 Ga0307408_100000007 Ga0307408_100000007318 184
147 3300031731 Ga0307405_10124063 Ga0307405_101240633 184
148 3300031852 Ga0307410_10001288 Ga0307410_1000128810 184
149 3300031903 Ga0307407_10018494 Ga0307407_100184942 184
150 3300031911 Ga0307412_10021428 Ga0307412_100214282 184
151 3300031995 Ga0307409_100000061 Ga0307409_1000000613 184
152 3300032002 Ga0307416_100000073 Ga0307416_10000007320 184
153 3300041997 Ga0439431_0034531 Ga0439431_0034531_360_938 184
154 3300045051 Ga0451576_0000146 Ga0451576_0000146_158539_159141 184
155 3300045051 Ga0451576_0001618 Ga0451576_0001618_20439_21041 184
156 3300049744 Ga0501083_0002600 Ga0501083_0002600_7978_8559 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

25

192

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rl4-assembly1.cif.gz_A plasmodium falciparum peptide deformylase complex with inhibitor 0.9117 4 172
1rl4-assembly1.cif.gz_A plasmodium falciparum peptide deformylase complex with inhibitor 0.9002 4 172
1lme-assembly2.cif.gz_B crystal structure of peptide deformylase from thermotoga maritima 0.8938 1 156
1ws1-assembly1.cif.gz_A structure analysis of peptide deformylase from bacillus cereus 0.8864 1 155
3fwx-assembly2.cif.gz_B the crystal structure of the peptide deformylase from vibrio cholerae o1 biovar el tor str. n16961 0.8838 3 175
ID Description Score Start End Superfamily
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.8929 1 156 3.90.45.10
af_K7VJY5_57_249_3.90.45.10 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.8879 2 178 3.90.45.10
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.8864 1 155 3.90.45.10
af_Q2G265_1_160_3.90.45.10 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.8785 1 157 3.90.45.10
5mtdB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.8755 4 150 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A2A2QR34-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9629 1 176 GO:0006412
GO:0042586
GO:0046872
AF-A0A848WWV6-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9521 1 174 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A0R2XAF4-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.95 3 174 GO:0006412
GO:0042586
GO:0046872
AF-A0A1G3Z7L1-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9483 5 172 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A840V5S9-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9472 1 170 GO:0006412
GO:0042586
GO:0043686
GO:0046872

Feature Viewer

pLDDT pTM Quality
84.44 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map