F223314

General Info

Members Datasets Scaffolds Average Seq Length
155 124 310 339

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0127376|Ga0501070_0127376_866_2089
Length 407
Sequence MLSAATNFASTSNAPRPSYATARLGYDLPQELIAQHPPTDRGTSRLIHVNVAEQRLTDCDFDFLPDLLPPHTLLVLNDSRVIPARVVGQRASGARVELLYHRYLGAGMIEAVIGSNARLPVGELLVLPGGWRGELLSEKSRDGSRVRLTDEQGRETGFEPTLSWLEAHGEVPLPPYIKRPAGARHSPPPAEDTARYQTVYAASAGSVAAPTAGLHFTGKMLTELQRRGHRLRYVTLHVGLGTFAPVRTADLAQHQMHREEFTLPDGLWAELEQQRKTANPVMAVGTTSLRALHSAGVQQSAAPPDGRAELPAKTLLQDATAFIYPGHGTHAADLLLTNFHLPGSTLLALVYAFGGEQLMRQVYTHAIASRYRFFSYGDCMLLDRRGAQLTSDGTVVEVSADRIDNNG

Samples

Sample ID Description Type Environment
1 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
68 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
71 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
72 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
76 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
80 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
81 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
82 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
83 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
84 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
85 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
86 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
87 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
88 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
89 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
90 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
91 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
92 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
93 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
94 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
95 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
96 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
97 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
98 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
99 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
100 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
103 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
108 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
109 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
110 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
111 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
114 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
120 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
121 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
122 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
123 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
124 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.94
Nodule 0
Rhizoplane 4.52
Rhizosphere 88.39
Stem 0
Stem Tuber 0
Unclassified 3.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501070_0127376 3300049586 Bacteria 2104
2 Ga0070676_10009308 3300005328 Bacteria 5313
3 Ga0070683_100310844 3300005329 Bacteria 1500
4 Ga0070690_100119515 3300005330 Bacteria 1767
5 Ga0070670_100039214 3300005331 Bacteria 4073
6 Ga0070670_100301980 3300005331 Bacteria 1400
7 Ga0070680_100420998 3300005336 Bacteria 1139
8 Ga0068868_100048806 3300005338 Bacteria 3321
9 Ga0070689_100076034 3300005340 Bacteria 2630
10 Ga0070668_100007330 3300005347 Bacteria 8180
11 Ga0070675_100346891 3300005354 Unclassified 1316
12 Ga0070671_100131798 3300005355 Bacteria 2105
13 Ga0070667_100079910 3300005367 Bacteria 2796
14 Ga0070714_100236353 3300005435 Bacteria 1685
15 Ga0070713_100040880 3300005436 Bacteria 3773
16 Ga0070713_100253616 3300005436 Bacteria 1605
17 Ga0070708_100000178 3300005445 Bacteria 45462
18 Ga0070708_100000721 3300005445 Bacteria 25106
19 Ga0070708_100054695 3300005445 Bacteria 3546
20 Ga0070706_100004453 3300005467 Bacteria 13529
21 Ga0070706_100059253 3300005467 Bacteria 3533
22 Ga0070707_100000704 3300005468 Bacteria 33310
23 Ga0070707_100001624 3300005468 Bacteria 21802
24 Ga0070698_100001198 3300005471 Bacteria 28769
25 Ga0070698_100008808 3300005471 Bacteria 10858
26 Ga0070699_100000699 3300005518 Bacteria 31141
27 Ga0070699_100002451 3300005518 Bacteria 16672
28 Ga0070684_100073475 3300005535 Bacteria 3013
29 Ga0070697_100000114 3300005536 Bacteria 63225
30 Ga0070697_100000846 3300005536 Bacteria 23019
31 Ga0068853_100349500 3300005539 Bacteria 1375
32 Ga0068855_100016110 3300005563 Bacteria 8989
33 Ga0070664_100011374 3300005564 Bacteria 7218
34 Ga0068854_100070962 3300005578 Bacteria 2547
35 Ga0068856_100064312 3300005614 Bacteria 3625
36 Ga0070702_100121079 3300005615 Bacteria 1638
37 Ga0081539_10000009 3300005985 Bacteria 509286
38 Ga0070717_10238207 3300006028 Bacteria 1604
39 Ga0075365_10006040 3300006038 Bacteria 6613
40 Ga0075428_100004920 3300006844 Bacteria 14840
41 Ga0075428_100008961 3300006844 Bacteria 11103
42 Ga0075428_100230841 3300006844 Bacteria 1997
43 Ga0075430_100001534 3300006846 Bacteria 18852
44 Ga0075431_100000158 3300006847 Bacteria 46980
45 Ga0075431_100023890 3300006847 Bacteria 6258
46 Ga0075433_10000972 3300006852 Bacteria 20350
47 Ga0075429_100097080 3300006880 Bacteria 2571
48 Ga0075429_100103295 3300006880 Bacteria 2489
49 Ga0068865_100074052 3300006881 Bacteria 2424
50 Ga0075436_100004382 3300006914 Bacteria 9689
51 Ga0075435_100359202 3300007076 Bacteria 1249
52 Ga0105240_10023363 3300009093 Bacteria 8179
53 Ga0105240_10397452 3300009093 Bacteria 1553
54 Ga0105245_10024843 3300009098 Bacteria 5265
55 Ga0114129_10000443 3300009147 Bacteria 49208
56 Ga0114129_10001075 3300009147 Bacteria 35911
57 Ga0114129_10024708 3300009147 Bacteria 8516
58 Ga0114129_10092434 3300009147 Bacteria 4191
59 Ga0105243_10154303 3300009148 Unclassified 1973
60 Ga0105243_10292409 3300009148 Bacteria 1473
61 Ga0105241_10014432 3300009174 Bacteria 5784
62 Ga0105237_10039393 3300009545 Bacteria 4771
63 Ga0105249_10030153 3300009553 Bacteria 4901
64 Ga0105239_10633755 3300010375 Bacteria 1220
65 Ga0163162_10114230 3300013306 Bacteria 2799
66 Ga0157375_10007418 3300013308 Bacteria 9600
67 Ga0182008_10108573 3300014497 Bacteria 1374
68 Ga0157376_10027541 3300014969 Bacteria 4507
69 Ga0213875_10014461 3300021388 Bacteria 3850
70 Ga0207682_10024017 3300025893 Bacteria 2411
71 Ga0207692_10039536 3300025898 Bacteria 2321
72 Ga0207699_10037162 3300025906 Bacteria 2782
73 Ga0207684_10000169 3300025910 Bacteria 109181
74 Ga0207684_10000274 3300025910 Bacteria 76497
75 Ga0207652_10042221 3300025921 Bacteria 3880
76 Ga0207646_10000240 3300025922 Bacteria 75609
77 Ga0207646_10012587 3300025922 Bacteria 8122
78 Ga0207664_10023914 3300025929 Bacteria 4585
79 Ga0207664_10123053 3300025929 Bacteria 2174
80 Ga0207644_10016541 3300025931 Bacteria 4962
81 Ga0207704_10075466 3300025938 Bacteria 2156
82 Ga0207689_10123324 3300025942 Bacteria 2131
83 Ga0207679_10226786 3300025945 Bacteria 1575
84 Ga0207640_10036452 3300025981 Bacteria 3088
85 Ga0207658_10010567 3300025986 Bacteria 6272
86 Ga0207641_10045000 3300026088 Bacteria 3714
87 Ga0268264_10143273 3300028381 Bacteria 2134
88 Ga0265337_1000301 3300028556 Bacteria 26365
89 Ga0265334_10001854 3300028573 Bacteria 10060
90 Ga0265316_10022638 3300031344 Bacteria 5291
91 Ga0307509_10081880 3300031507 Bacteria 3332
92 Ga0307508_10031314 3300031616 Bacteria 4808
93 Ga0316575_10014817 3300031665 Bacteria 2932
94 Ga0307416_100142924 3300032002 Bacteria 2179
95 Ga0307411_10069800 3300032005 Unclassified 2375
96 Ga0373954_0000772 3300035118 Bacteria 12332
97 Ga0316574_0002076 3300035398 Bacteria 9908
98 Ga0373937_0520381 3300036401 Bacteria 1130
99 Ga0395905_0015148 3300037471 Bacteria 7337
100 Ga0436364_0129087 3300037853 Bacteria 11559
101 Ga0436364_0621766 3300037853 Bacteria 1630
102 Ga0436364_1388052 3300037853 Unclassified 3627
103 Ga0400485_14331 3300038735 Bacteria 2383
104 Ga0400486_28206 3300038742 Bacteria 2223
105 Ga0495651_0003179 3300046462 Bacteria 12620
106 Ga0495639_0062767 3300046475 Bacteria 1705
107 Ga0495628_0392153 3300046516 Bacteria 1015
108 Ga0495663_0000213 3300046525 Bacteria 23233
109 Ga0495640_0114224 3300046533 Bacteria 1761
110 Ga0495587_0007796 3300046536 Bacteria 6917
111 Ga0495598_0000029 3300046537 Bacteria 22095
112 Ga0495645_0000464 3300046543 Bacteria 28008
113 Ga0495668_0052931 3300046616 Bacteria 2245
114 Ga0495668_0076481 3300046616 Bacteria 1838
115 Ga0495646_0035699 3300046680 Bacteria 3083
116 Ga0495604_0003026 3300047317 Bacteria 13452
117 Ga0495672_0005421 3300047320 Bacteria 10125
118 Ga0495684_0098470 3300047471 Bacteria 2211
119 Ga0495602_0207992 3300048088 Bacteria 1488
120 Ga0496101_0081919 3300048904 Bacteria 2388
121 Ga0496102_0046067 3300048905 Bacteria 3960
122 Ga0496103_0223076 3300048906 Bacteria 1212
123 Ga0496105_0030767 3300048908 Bacteria 4400
124 Ga0496106_0226746 3300048909 Bacteria 1491
125 Ga0496112_0052234 3300048915 Bacteria 4011
126 Ga0496113_0187202 3300048916 Bacteria 1642
127 Ga0501039_0070571 3300049575 Bacteria 2714
128 Ga0501040_0222311 3300049576 Bacteria 1344
129 Ga0501043_0369640 3300049579 Bacteria 1087
130 Ga0501047_0000157 3300049581 Bacteria 82600
131 Ga0501067_0071537 3300049583 Bacteria 1921
132 Ga0501071_0138379 3300049587 Bacteria 1812
133 Ga0501074_0247993 3300049590 Bacteria 1266
134 Ga0501075_0099441 3300049591 Bacteria 2209
135 Ga0501079_0127705 3300049741 Bacteria 1978
136 Ga0501080_0134627 3300049742 Bacteria 2287
137 Ga0501081_0227452 3300049743 Unclassified 1358
138 nmdc:mga0yw44_105172_c1 3300050492 Bacteria 1803
139 nmdc:mga05p37_112647_c1 3300050507 Bacteria 3346
140 nmdc:mga05p37_199_c1 3300050507 Bacteria 59838
141 nmdc:mga05p37_38_c1 3300050507 Bacteria 109166
142 nmdc:mga05p37_78032_c1 3300050507 Bacteria 4078
143 nmdc:mga09592_27956_c1 3300050508 Bacteria 4682
144 nmdc:mga09592_91535_c1 3300050508 Bacteria 2599
145 nmdc:mga09592_96142_c1 3300050508 Bacteria 2534
146 nmdc:mga0qj67_1937_c1 3300050509 Bacteria 14720
147 nmdc:mga06r32_287_c1 3300050510 Bacteria 41922
148 nmdc:mga06r32_7196_c1 3300050510 Bacteria 10028
149 nmdc:mga0n895_61_c1 3300050512 Bacteria 63108
150 nmdc:mga0rr50_1190_c1 3300050513 Bacteria 14125
151 nmdc:mga08x19_8690_c1 3300050514 Bacteria 6057
152 nmdc:mga0a205_122_c1 3300050515 Bacteria 47141
153 nmdc:mga0a205_165057_c1 3300050515 Bacteria 2110
154 Ga0500637_0093241 3300053178 Bacteria 1745
155 Ga0501082_0013937 3300060353 Bacteria 6914
156 Ga0501070_0127376
157 Ga0070676_10009308
158 Ga0070683_100310844
159 Ga0070690_100119515
160 Ga0070670_100039214
161 Ga0070670_100301980
162 Ga0070680_100420998
163 Ga0068868_100048806
164 Ga0070689_100076034
165 Ga0070668_100007330
166 Ga0070675_100346891
167 Ga0070671_100131798
168 Ga0070667_100079910
169 Ga0070714_100236353
170 Ga0070713_100040880
171 Ga0070713_100253616
172 Ga0070708_100000178
173 Ga0070708_100000721
174 Ga0070708_100054695
175 Ga0070706_100004453
176 Ga0070706_100059253
177 Ga0070707_100000704
178 Ga0070707_100001624
179 Ga0070698_100001198
180 Ga0070698_100008808
181 Ga0070699_100000699
182 Ga0070699_100002451
183 Ga0070684_100073475
184 Ga0070697_100000114
185 Ga0070697_100000846
186 Ga0068853_100349500
187 Ga0068855_100016110
188 Ga0070664_100011374
189 Ga0068854_100070962
190 Ga0068856_100064312
191 Ga0070702_100121079
192 Ga0081539_10000009
193 Ga0070717_10238207
194 Ga0075365_10006040
195 Ga0075428_100004920
196 Ga0075428_100008961
197 Ga0075428_100230841
198 Ga0075430_100001534
199 Ga0075431_100000158
200 Ga0075431_100023890
201 Ga0075433_10000972
202 Ga0075429_100097080
203 Ga0075429_100103295
204 Ga0068865_100074052
205 Ga0075436_100004382
206 Ga0075435_100359202
207 Ga0105240_10023363
208 Ga0105240_10397452
209 Ga0105245_10024843
210 Ga0114129_10000443
211 Ga0114129_10001075
212 Ga0114129_10024708
213 Ga0114129_10092434
214 Ga0105243_10154303
215 Ga0105243_10292409
216 Ga0105241_10014432
217 Ga0105237_10039393
218 Ga0105249_10030153
219 Ga0105239_10633755
220 Ga0163162_10114230
221 Ga0157375_10007418
222 Ga0182008_10108573
223 Ga0157376_10027541
224 Ga0213875_10014461
225 Ga0207682_10024017
226 Ga0207692_10039536
227 Ga0207699_10037162
228 Ga0207684_10000169
229 Ga0207684_10000274
230 Ga0207652_10042221
231 Ga0207646_10000240
232 Ga0207646_10012587
233 Ga0207664_10023914
234 Ga0207664_10123053
235 Ga0207644_10016541
236 Ga0207704_10075466
237 Ga0207689_10123324
238 Ga0207679_10226786
239 Ga0207640_10036452
240 Ga0207658_10010567
241 Ga0207641_10045000
242 Ga0268264_10143273
243 Ga0265337_1000301
244 Ga0265334_10001854
245 Ga0265316_10022638
246 Ga0307509_10081880
247 Ga0307508_10031314
248 Ga0316575_10014817
249 Ga0307416_100142924
250 Ga0307411_10069800
251 Ga0373954_0000772
252 Ga0316574_0002076
253 Ga0373937_0520381
254 Ga0395905_0015148
255 Ga0436364_0129087
256 Ga0436364_0621766
257 Ga0436364_1388052
258 Ga0400485_14331
259 Ga0400486_28206
260 Ga0495651_0003179
261 Ga0495639_0062767
262 Ga0495628_0392153
263 Ga0495663_0000213
264 Ga0495640_0114224
265 Ga0495587_0007796
266 Ga0495598_0000029
267 Ga0495645_0000464
268 Ga0495668_0052931
269 Ga0495668_0076481
270 Ga0495646_0035699
271 Ga0495604_0003026
272 Ga0495672_0005421
273 Ga0495684_0098470
274 Ga0495602_0207992
275 Ga0496101_0081919
276 Ga0496102_0046067
277 Ga0496103_0223076
278 Ga0496105_0030767
279 Ga0496106_0226746
280 Ga0496112_0052234
281 Ga0496113_0187202
282 Ga0501039_0070571
283 Ga0501040_0222311
284 Ga0501043_0369640
285 Ga0501047_0000157
286 Ga0501067_0071537
287 Ga0501071_0138379
288 Ga0501074_0247993
289 Ga0501075_0099441
290 Ga0501079_0127705
291 Ga0501080_0134627
292 Ga0501081_0227452
293 nmdc:mga0yw44_105172_c1
294 nmdc:mga05p37_112647_c1
295 nmdc:mga05p37_199_c1
296 nmdc:mga05p37_38_c1
297 nmdc:mga05p37_78032_c1
298 nmdc:mga09592_27956_c1
299 nmdc:mga09592_91535_c1
300 nmdc:mga09592_96142_c1
301 nmdc:mga0qj67_1937_c1
302 nmdc:mga06r32_287_c1
303 nmdc:mga06r32_7196_c1
304 nmdc:mga0n895_61_c1
305 nmdc:mga0rr50_1190_c1
306 nmdc:mga08x19_8690_c1
307 nmdc:mga0a205_122_c1
308 nmdc:mga0a205_165057_c1
309 Ga0500637_0093241
310 Ga0501082_0013937

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02547

Queuosine_synth

Queuosine biosynthesis protein

21

382

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lqz-assembly1.cif.gz_A structure of f-atpase from pichia angusta, state1 0.7101 67 115
6q45-assembly1.cif.gz_C f1-atpase from fusobacterium nucleatum 0.7085 67 115
6q45-assembly2.cif.gz_K f1-atpase from fusobacterium nucleatum 0.7084 67 115
5hkk-assembly1.cif.gz_A caldalaklibacillus thermarum f1-atpase (wild type) 0.7079 63 115
5dn6-assembly1.cif.gz_C atp synthase from paracoccus denitrificans 0.6958 67 118
ID Description Score Start End Superfamily
af_P0A7F9_64_163_3.40.1780.10 Alpha Beta;3-Layer(aba) Sandwich;QueA-like;QueA-like 0.8916 49 148 3.40.1780.10
af_P0A7F9_64_163_3.40.1780.10 Alpha Beta;3-Layer(aba) Sandwich;QueA-like;QueA-like 0.875 49 148 3.40.1780.10
af_F4HSA3_9_144_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8676 172 189 3.40.50.1010
1vkyA02 Mainly Beta;Beta Barrel;Thrombin, subunit H;QueA-like 0.8577 49 129 2.40.10.240
1vkyA02 Mainly Beta;Beta Barrel;Thrombin, subunit H;QueA-like 0.8473 49 129 2.40.10.240
ID Description Score Start End GO Terms
AF-A0A2V8JEE4-F1-model_v4 tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA 0.9967 217 328 GO:0002099
GO:0005737
GO:0008616
GO:0051075
AF-A0A0U2JFI9-F1-model_v4 Queuosine biosynthesis protein 0.9945 234 328 GO:0002099
GO:0005737
GO:0008616
GO:0051075
AF-A0A353DBH3-F1-model_v4 tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA 0.9908 217 328 GO:0002099
GO:0005737
GO:0008616
GO:0051075
AF-A0A3M1RX12-F1-model_v4 S-adenosylmethionine:tRNA ribosyltransferase-isomerase 0.9883 160 328 GO:0002099
GO:0005737
GO:0008616
GO:0051075
AF-A0A424SNB6-F1-model_v4 S-adenosylmethionine:tRNA ribosyltransferase-isomerase 0.987 189 327 GO:0002099
GO:0005737
GO:0008616
GO:0051075

Map