F222306
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 155 | 107 | 155 | 396 |
Family's Representative Sequence
| Representative Sequence | 3300014325|Ga0163163_10000293|Ga0163163_1000029317 |
| Length | 390 |
| Sequence | MKQYKYLIIGGGMAADAAVQGIRSVDPIGEIGVISAERNPPYNRPPLSKGLWKGEPVDTIWRKTNEQNVTVHLGCTASLLDPGQKRVADTDGNSYSWEKLLLATGGSPRRFSFGGDEVIYFRTFVDYQQLRALTEKGQRFAVIGAGFIGSEIAAALAISRKEVVLIFPGQSIGEHIYPRALSQFVTDFYRQKGVELLAGEKVSGLERRGTQLAVKLSQREILVDGAVAGVGIEPNDKLGQAAGLKVENGIVVDEFLRTSHPDIYAAGDVARFFNPALGKTIRVEHEDNANTMGKLAGLNIAGKSEPYHHLPFFYSDMFELGYEAVGELDSRLETFADWKHLNKEGVIYYLHDGRVRGVLLWNVWGQVEAARKLIAEPGPFRAKDLEGRLK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 22 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 23 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 24 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 25 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 26 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 27 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 28 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 65 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 66 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 67 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 68 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 69 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 70 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 71 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 72 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 73 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 74 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 75 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 76 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 77 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 78 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 79 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 80 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 81 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 82 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 83 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 84 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 85 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 86 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 96 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 97 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 98 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 99 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 100 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 101 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 102 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 103 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 104 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 105 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 106 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 107 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.65 |
| Rhizosphere | 99.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10027547 | 3300005290 | Bacteria | 2259 |
| 2 | Ga0070676_10101670 | 3300005328 | Bacteria | 1777 |
| 3 | Ga0070680_100001061 | 3300005336 | Bacteria | 19707 |
| 4 | Ga0068868_100095070 | 3300005338 | Bacteria | 2405 |
| 5 | Ga0070660_100112643 | 3300005339 | Bacteria | 2166 |
| 6 | Ga0070668_100063149 | 3300005347 | Bacteria | 2870 |
| 7 | Ga0070669_100025539 | 3300005353 | Bacteria | 4244 |
| 8 | Ga0070675_100185752 | 3300005354 | Bacteria | 1799 |
| 9 | Ga0070673_100041338 | 3300005364 | Bacteria | 3545 |
| 10 | Ga0070673_100102447 | 3300005364 | Bacteria | 2360 |
| 11 | Ga0070705_100002573 | 3300005440 | Bacteria | 9099 |
| 12 | Ga0070705_100047394 | 3300005440 | Bacteria | 2484 |
| 13 | Ga0070694_100012005 | 3300005444 | Bacteria | 5378 |
| 14 | Ga0070708_100003702 | 3300005445 | Bacteria | 11987 |
| 15 | Ga0070708_100020014 | 3300005445 | Bacteria | 5636 |
| 16 | Ga0070708_100085645 | 3300005445 | Bacteria | 2861 |
| 17 | Ga0070708_100105277 | 3300005445 | Bacteria | 2588 |
| 18 | Ga0070681_10132307 | 3300005458 | Bacteria | 2426 |
| 19 | Ga0070706_100012926 | 3300005467 | Bacteria | 7727 |
| 20 | Ga0070706_100106699 | 3300005467 | Bacteria | 2606 |
| 21 | Ga0070707_100022009 | 3300005468 | Bacteria | 6027 |
| 22 | Ga0070707_100091146 | 3300005468 | Unclassified | 2951 |
| 23 | Ga0070707_100371433 | 3300005468 | Unclassified | 1389 |
| 24 | Ga0070698_100018022 | 3300005471 | Bacteria | 7435 |
| 25 | Ga0070698_100355120 | 3300005471 | Bacteria | 1397 |
| 26 | Ga0070699_100001877 | 3300005518 | Bacteria | 19007 |
| 27 | Ga0070699_100009182 | 3300005518 | Bacteria | 8574 |
| 28 | Ga0070697_100022275 | 3300005536 | Bacteria | 5028 |
| 29 | Ga0070697_100137543 | 3300005536 | Bacteria | 2052 |
| 30 | Ga0068853_100197058 | 3300005539 | Bacteria | 1832 |
| 31 | Ga0070704_100031840 | 3300005549 | Bacteria | 3551 |
| 32 | Ga0070704_100065237 | 3300005549 | Bacteria | 2620 |
| 33 | Ga0068855_100069636 | 3300005563 | Bacteria | 4094 |
| 34 | Ga0068857_100019348 | 3300005577 | Bacteria | 5977 |
| 35 | Ga0068857_100068854 | 3300005577 | Bacteria | 3150 |
| 36 | Ga0068854_100027054 | 3300005578 | Bacteria | 3949 |
| 37 | Ga0068856_100174574 | 3300005614 | Bacteria | 2161 |
| 38 | Ga0081455_10020604 | 3300005937 | Bacteria | 6203 |
| 39 | Ga0075434_100107560 | 3300006871 | Bacteria | 2799 |
| 40 | Ga0075434_100137344 | 3300006871 | Bacteria | 2464 |
| 41 | Ga0075436_100026635 | 3300006914 | Bacteria | 3981 |
| 42 | Ga0105240_10037953 | 3300009093 | Bacteria | 6185 |
| 43 | Ga0105240_10351536 | 3300009093 | Bacteria | 1672 |
| 44 | Ga0114129_10031572 | 3300009147 | Bacteria | 7486 |
| 45 | Ga0114129_10430043 | 3300009147 | Bacteria | 1735 |
| 46 | Ga0105241_10013399 | 3300009174 | Bacteria | 6010 |
| 47 | Ga0105241_10022591 | 3300009174 | Bacteria | 4660 |
| 48 | Ga0105237_10035486 | 3300009545 | Bacteria | 5046 |
| 49 | Ga0105238_10050088 | 3300009551 | Bacteria | 4205 |
| 50 | Ga0105238_10110866 | 3300009551 | Bacteria | 2724 |
| 51 | Ga0105238_10167214 | 3300009551 | Bacteria | 2175 |
| 52 | Ga0105249_10224548 | 3300009553 | Bacteria | 1850 |
| 53 | Ga0105239_10015615 | 3300010375 | Bacteria | 8408 |
| 54 | Ga0105239_10151016 | 3300010375 | Bacteria | 2592 |
| 55 | Ga0157374_10149595 | 3300013296 | Bacteria | 2269 |
| 56 | Ga0157378_10282655 | 3300013297 | Bacteria | 1600 |
| 57 | Ga0157372_10163028 | 3300013307 | Bacteria | 2577 |
| 58 | Ga0157372_10213661 | 3300013307 | Bacteria | 2235 |
| 59 | Ga0163163_10000293 | 3300014325 | Bacteria | 49814 |
| 60 | Ga0207697_10003359 | 3300025315 | Bacteria | 7959 |
| 61 | Ga0207697_10025809 | 3300025315 | Bacteria | 2402 |
| 62 | Ga0207682_10055900 | 3300025893 | Bacteria | 1642 |
| 63 | Ga0207688_10024098 | 3300025901 | Bacteria | 3336 |
| 64 | Ga0207680_10036067 | 3300025903 | Bacteria | 2846 |
| 65 | Ga0207645_10072154 | 3300025907 | Bacteria | 2210 |
| 66 | Ga0207684_10000563 | 3300025910 | Bacteria | 45289 |
| 67 | Ga0207684_10004380 | 3300025910 | Bacteria | 13323 |
| 68 | Ga0207684_10024410 | 3300025910 | Bacteria | 5155 |
| 69 | Ga0207684_10042690 | 3300025910 | Unclassified | 3845 |
| 70 | Ga0207684_10160597 | 3300025910 | Bacteria | 1935 |
| 71 | Ga0207707_10056264 | 3300025912 | Bacteria | 3422 |
| 72 | Ga0207707_10127519 | 3300025912 | Bacteria | 2225 |
| 73 | Ga0207695_10007579 | 3300025913 | Bacteria | 13761 |
| 74 | Ga0207695_10217693 | 3300025913 | Unclassified | 1818 |
| 75 | Ga0207646_10000002 | 3300025922 | Bacteria | 550880 |
| 76 | Ga0207646_10017511 | 3300025922 | Bacteria | 6702 |
| 77 | Ga0207646_10059590 | 3300025922 | Bacteria | 3409 |
| 78 | Ga0207646_10168734 | 3300025922 | Bacteria | 1976 |
| 79 | Ga0207681_10083924 | 3300025923 | Bacteria | 2256 |
| 80 | Ga0207681_10144601 | 3300025923 | Bacteria | 1775 |
| 81 | Ga0207650_10054554 | 3300025925 | Bacteria | 2965 |
| 82 | Ga0207659_10206764 | 3300025926 | Bacteria | 1571 |
| 83 | Ga0207644_10051740 | 3300025931 | Bacteria | 2949 |
| 84 | Ga0207706_10148619 | 3300025933 | Bacteria | 2061 |
| 85 | Ga0207691_10076710 | 3300025940 | Bacteria | 3011 |
| 86 | Ga0207689_10221379 | 3300025942 | Bacteria | 1564 |
| 87 | Ga0207667_10255015 | 3300025949 | Unclassified | 1794 |
| 88 | Ga0207667_10280902 | 3300025949 | Bacteria | 1701 |
| 89 | Ga0207712_10051159 | 3300025961 | Bacteria | 2888 |
| 90 | Ga0207668_10013725 | 3300025972 | Bacteria | 4998 |
| 91 | Ga0207640_10247194 | 3300025981 | Bacteria | 1382 |
| 92 | Ga0207658_10094533 | 3300025986 | Bacteria | 2326 |
| 93 | Ga0207658_10321104 | 3300025986 | Bacteria | 1340 |
| 94 | Ga0207678_10061522 | 3300026067 | Bacteria | 3229 |
| 95 | Ga0207674_10015771 | 3300026116 | Bacteria | 8289 |
| 96 | Ga0207674_10076535 | 3300026116 | Bacteria | 3353 |
| 97 | Ga0207674_10349956 | 3300026116 | Unclassified | 1428 |
| 98 | Ga0207683_10156679 | 3300026121 | Bacteria | 2057 |
| 99 | Ga0268266_10023848 | 3300028379 | Bacteria | 5206 |
| 100 | Ga0265334_10005004 | 3300028573 | Bacteria | 5825 |
| 101 | Ga0265318_10006601 | 3300028577 | Bacteria | 5326 |
| 102 | Ga0265318_10010970 | 3300028577 | Bacteria | 3924 |
| 103 | Ga0265338_10013889 | 3300028800 | Bacteria | 9040 |
| 104 | Ga0265338_10013931 | 3300028800 | Bacteria | 9021 |
| 105 | Ga0265338_10014036 | 3300028800 | Bacteria | 8969 |
| 106 | Ga0265330_10010441 | 3300031235 | Bacteria | 4377 |
| 107 | Ga0265332_10003709 | 3300031238 | Bacteria | 7311 |
| 108 | Ga0265320_10029087 | 3300031240 | Bacteria | 2862 |
| 109 | Ga0265340_10010831 | 3300031247 | Bacteria | 4868 |
| 110 | Ga0265339_10037559 | 3300031249 | Bacteria | 2706 |
| 111 | Ga0265331_10003406 | 3300031250 | Bacteria | 10287 |
| 112 | Ga0265316_10008877 | 3300031344 | Bacteria | 9283 |
| 113 | Ga0265316_10140691 | 3300031344 | Bacteria | 1813 |
| 114 | Ga0265342_10007346 | 3300031712 | Bacteria | 8084 |
| 115 | Ga0307412_10014342 | 3300031911 | Unclassified | 4671 |
| 116 | Ga0307409_100094718 | 3300031995 | Bacteria | 2458 |
| 117 | Ga0307416_100022035 | 3300032002 | Bacteria | 4588 |
| 118 | Ga0307416_100100454 | 3300032002 | Bacteria | 2516 |
| 119 | Ga0307416_100371913 | 3300032002 | Unclassified | 1456 |
| 120 | Ga0307415_100168218 | 3300032126 | Unclassified | 1707 |
| 121 | Ga0373946_0014605 | 3300035171 | Bacteria | 2963 |
| 122 | Ga0373927_0006284 | 3300035695 | Bacteria | 8105 |
| 123 | Ga0316582_0111528 | 3300036647 | Unclassified | 1821 |
| 124 | Ga0373925_0001245 | 3300037068 | Bacteria | 22453 |
| 125 | Ga0451577_0154088 | 3300042876 | Unclassified | 2068 |
| 126 | Ga0453684_0008870 | 3300044712 | Bacteria | 17816 |
| 127 | Ga0453684_0173896 | 3300044712 | Unclassified | 2535 |
| 128 | Ga0453684_0252379 | 3300044712 | Bacteria | 2025 |
| 129 | Ga0453684_0296286 | 3300044712 | Unclassified | 1840 |
| 130 | Ga0451576_0000739 | 3300045051 | Bacteria | 65393 |
| 131 | Ga0451576_0006776 | 3300045051 | Bacteria | 13938 |
| 132 | Ga0495662_0064453 | 3300046476 | Unclassified | 1771 |
| 133 | Ga0495630_0000038 | 3300046517 | Bacteria | 113319 |
| 134 | Ga0495630_0012724 | 3300046517 | Bacteria | 6114 |
| 135 | Ga0495663_0011909 | 3300046525 | Unclassified | 2423 |
| 136 | Ga0495586_0000011 | 3300046535 | Bacteria | 139442 |
| 137 | Ga0495635_0029217 | 3300046663 | Bacteria | 3833 |
| 138 | Ga0495657_0020300 | 3300046675 | Bacteria | 4779 |
| 139 | Ga0495674_0017586 | 3300047319 | Bacteria | 6656 |
| 140 | Ga0495676_0029618 | 3300047321 | Bacteria | 4660 |
| 141 | Ga0495680_0131499 | 3300047322 | Bacteria | 1838 |
| 142 | Ga0496102_0042350 | 3300048905 | Bacteria | 4126 |
| 143 | Ga0501032_0000206 | 3300049569 | Bacteria | 49241 |
| 144 | Ga0501036_0091142 | 3300049572 | Bacteria | 2575 |
| 145 | Ga0501043_0055256 | 3300049579 | Bacteria | 3119 |
| 146 | Ga0501046_0000947 | 3300049580 | Bacteria | 28449 |
| 147 | Ga0501047_0000322 | 3300049581 | Bacteria | 55407 |
| 148 | Ga0501070_0035941 | 3300049586 | Bacteria | 4137 |
| 149 | Ga0501035_0001493 | 3300049822 | Bacteria | 23956 |
| 150 | Ga0501044_0000129 | 3300049823 | Bacteria | 92557 |
| 151 | Ga0501044_0001199 | 3300049823 | Bacteria | 30731 |
| 152 | nmdc:mga05p37_95579_c1 | 3300050507 | Bacteria | 3661 |
| 153 | nmdc:mga0n895_113009_c1 | 3300050512 | Bacteria | 2733 |
| 154 | nmdc:mga08x19_233264_c1 | 3300050514 | Bacteria | 1267 |
| 155 | Ga0495612_0024016 | 3300053078 | Bacteria | 2448 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009551 | Ga0105238_10167214 | Ga0105238_101672142 | 379 |
| 2 | 3300050514 | nmdc:mga08x19_233264_c1 | nmdc:mga08x19_233264_c1_116_1255 | 379 |
| 3 | 3300005445 | Ga0070708_100020014 | Ga0070708_1000200145 | 382 |
| 4 | 3300005467 | Ga0070706_100106699 | Ga0070706_1001066993 | 382 |
| 5 | 3300025910 | Ga0207684_10024410 | Ga0207684_100244106 | 382 |
| 6 | 3300005336 | Ga0070680_100001061 | Ga0070680_10000106110 | 384 |
| 7 | 3300005444 | Ga0070694_100012005 | Ga0070694_1000120053 | 384 |
| 8 | 3300013307 | Ga0157372_10163028 | Ga0157372_101630282 | 386 |
| 9 | 3300005353 | Ga0070669_100025539 | Ga0070669_1000255393 | 389 |
| 10 | 3300009551 | Ga0105238_10050088 | Ga0105238_100500882 | 389 |
| 11 | 3300025315 | Ga0207697_10003359 | Ga0207697_100033596 | 389 |
| 12 | 3300025923 | Ga0207681_10144601 | Ga0207681_101446012 | 389 |
| 13 | 3300025972 | Ga0207668_10013725 | Ga0207668_100137253 | 389 |
| 14 | 3300046663 | Ga0495635_0029217 | Ga0495635_0029217_1245_2414 | 389 |
| 15 | 3300046675 | Ga0495657_0020300 | Ga0495657_0020300_3600_4769 | 389 |
| 16 | 3300047322 | Ga0495680_0131499 | Ga0495680_0131499_432_1601 | 389 |
| 17 | 3300014325 | Ga0163163_10000293 | Ga0163163_1000029317 | 390 |
| 18 | 3300005468 | Ga0070707_100022009 | Ga0070707_1000220095 | 391 |
| 19 | 3300005468 | Ga0070707_100371433 | Ga0070707_1003714331 | 391 |
| 20 | 3300005471 | Ga0070698_100355120 | Ga0070698_1003551201 | 391 |
| 21 | 3300005518 | Ga0070699_100001877 | Ga0070699_1000018771 | 391 |
| 22 | 3300006871 | Ga0075434_100137344 | Ga0075434_1001373441 | 391 |
| 23 | 3300009093 | Ga0105240_10037953 | Ga0105240_100379536 | 391 |
| 24 | 3300009553 | Ga0105249_10224548 | Ga0105249_102245482 | 391 |
| 25 | 3300025910 | Ga0207684_10000563 | Ga0207684_1000056340 | 391 |
| 26 | 3300025910 | Ga0207684_10160597 | Ga0207684_101605971 | 391 |
| 27 | 3300025913 | Ga0207695_10217693 | Ga0207695_102176932 | 391 |
| 28 | 3300025922 | Ga0207646_10017511 | Ga0207646_100175115 | 391 |
| 29 | 3300025949 | Ga0207667_10255015 | Ga0207667_102550151 | 391 |
| 30 | 3300025961 | Ga0207712_10051159 | Ga0207712_100511592 | 391 |
| 31 | 3300046525 | Ga0495663_0011909 | Ga0495663_0011909_1078_2253 | 391 |
| 32 | 3300005339 | Ga0070660_100112643 | Ga0070660_1001126431 | 392 |
| 33 | 3300005440 | Ga0070705_100002573 | Ga0070705_1000025738 | 392 |
| 34 | 3300005445 | Ga0070708_100003702 | Ga0070708_1000037022 | 392 |
| 35 | 3300005445 | Ga0070708_100105277 | Ga0070708_1001052771 | 392 |
| 36 | 3300005458 | Ga0070681_10132307 | Ga0070681_101323072 | 392 |
| 37 | 3300005536 | Ga0070697_100137543 | Ga0070697_1001375432 | 392 |
| 38 | 3300005549 | Ga0070704_100031840 | Ga0070704_1000318402 | 392 |
| 39 | 3300005563 | Ga0068855_100069636 | Ga0068855_1000696362 | 392 |
| 40 | 3300005577 | Ga0068857_100068854 | Ga0068857_1000688545 | 392 |
| 41 | 3300009093 | Ga0105240_10351536 | Ga0105240_103515362 | 392 |
| 42 | 3300009174 | Ga0105241_10013399 | Ga0105241_100133994 | 392 |
| 43 | 3300009174 | Ga0105241_10022591 | Ga0105241_100225912 | 392 |
| 44 | 3300009545 | Ga0105237_10035486 | Ga0105237_100354867 | 392 |
| 45 | 3300009551 | Ga0105238_10110866 | Ga0105238_101108663 | 392 |
| 46 | 3300010375 | Ga0105239_10015615 | Ga0105239_100156152 | 392 |
| 47 | 3300010375 | Ga0105239_10151016 | Ga0105239_101510162 | 392 |
| 48 | 3300025912 | Ga0207707_10056264 | Ga0207707_100562643 | 392 |
| 49 | 3300026116 | Ga0207674_10015771 | Ga0207674_100157714 | 392 |
| 50 | 3300026116 | Ga0207674_10076535 | Ga0207674_100765352 | 392 |
| 51 | 3300032002 | Ga0307416_100100454 | Ga0307416_1001004544 | 392 |
| 52 | 3300044712 | Ga0453684_0296286 | Ga0453684_0296286_454_1632 | 392 |
| 53 | 3300045051 | Ga0451576_0000739 | Ga0451576_0000739_62302_63480 | 392 |
| 54 | 3300049586 | Ga0501070_0035941 | Ga0501070_0035941_933_2114 | 392 |
| 55 | 3300049823 | Ga0501044_0000129 | Ga0501044_0000129_60566_61744 | 392 |
| 56 | 3300006914 | Ga0075436_100026635 | Ga0075436_1000266352 | 393 |
| 57 | 3300028577 | Ga0265318_10006601 | Ga0265318_100066015 | 393 |
| 58 | 3300028800 | Ga0265338_10014036 | Ga0265338_100140366 | 393 |
| 59 | 3300031240 | Ga0265320_10029087 | Ga0265320_100290873 | 393 |
| 60 | 3300031247 | Ga0265340_10010831 | Ga0265340_100108314 | 393 |
| 61 | 3300031344 | Ga0265316_10140691 | Ga0265316_101406912 | 393 |
| 62 | 3300031911 | Ga0307412_10014342 | Ga0307412_100143425 | 393 |
| 63 | 3300032002 | Ga0307416_100022035 | Ga0307416_1000220353 | 393 |
| 64 | 3300005445 | Ga0070708_100085645 | Ga0070708_1000856452 | 394 |
| 65 | 3300005467 | Ga0070706_100012926 | Ga0070706_1000129262 | 394 |
| 66 | 3300005468 | Ga0070707_100091146 | Ga0070707_1000911462 | 394 |
| 67 | 3300005471 | Ga0070698_100018022 | Ga0070698_1000180222 | 394 |
| 68 | 3300005577 | Ga0068857_100019348 | Ga0068857_1000193481 | 394 |
| 69 | 3300025910 | Ga0207684_10042690 | Ga0207684_100426902 | 394 |
| 70 | 3300025913 | Ga0207695_10007579 | Ga0207695_100075798 | 394 |
| 71 | 3300025922 | Ga0207646_10059590 | Ga0207646_100595904 | 394 |
| 72 | 3300025922 | Ga0207646_10168734 | Ga0207646_101687342 | 394 |
| 73 | 3300026116 | Ga0207674_10349956 | Ga0207674_103499561 | 394 |
| 74 | 3300032002 | Ga0307416_100371913 | Ga0307416_1003719132 | 394 |
| 75 | 3300035171 | Ga0373946_0014605 | Ga0373946_0014605_807_1994 | 394 |
| 76 | 3300035695 | Ga0373927_0006284 | Ga0373927_0006284_1563_2750 | 394 |
| 77 | 3300037068 | Ga0373925_0001245 | Ga0373925_0001245_3194_4381 | 394 |
| 78 | 3300042876 | Ga0451577_0154088 | Ga0451577_0154088_739_1923 | 394 |
| 79 | 3300044712 | Ga0453684_0173896 | Ga0453684_0173896_1123_2307 | 394 |
| 80 | 3300046476 | Ga0495662_0064453 | Ga0495662_0064453_47_1231 | 394 |
| 81 | 3300046517 | Ga0495630_0000038 | Ga0495630_0000038_4770_5954 | 394 |
| 82 | 3300046517 | Ga0495630_0012724 | Ga0495630_0012724_1280_2467 | 394 |
| 83 | 3300046535 | Ga0495586_0000011 | Ga0495586_0000011_3114_4298 | 394 |
| 84 | 3300047319 | Ga0495674_0017586 | Ga0495674_0017586_233_1417 | 394 |
| 85 | 3300047321 | Ga0495676_0029618 | Ga0495676_0029618_1229_2413 | 394 |
| 86 | 3300005937 | Ga0081455_10020604 | Ga0081455_100206044 | 396 |
| 87 | 3300028577 | Ga0265318_10010970 | Ga0265318_100109703 | 396 |
| 88 | 3300031235 | Ga0265330_10010441 | Ga0265330_100104412 | 396 |
| 89 | 3300031238 | Ga0265332_10003709 | Ga0265332_100037093 | 396 |
| 90 | 3300031249 | Ga0265339_10037559 | Ga0265339_100375592 | 396 |
| 91 | 3300031250 | Ga0265331_10003406 | Ga0265331_100034069 | 396 |
| 92 | 3300031344 | Ga0265316_10008877 | Ga0265316_100088777 | 396 |
| 93 | 3300031712 | Ga0265342_10007346 | Ga0265342_100073466 | 396 |
| 94 | 3300031995 | Ga0307409_100094718 | Ga0307409_1000947182 | 396 |
| 95 | 3300032126 | Ga0307415_100168218 | Ga0307415_1001682182 | 396 |
| 96 | 3300005328 | Ga0070676_10101670 | Ga0070676_101016702 | 397 |
| 97 | 3300005347 | Ga0070668_100063149 | Ga0070668_1000631491 | 397 |
| 98 | 3300005354 | Ga0070675_100185752 | Ga0070675_1001857522 | 397 |
| 99 | 3300013297 | Ga0157378_10282655 | Ga0157378_102826552 | 397 |
| 100 | 3300025893 | Ga0207682_10055900 | Ga0207682_100559002 | 397 |
| 101 | 3300025907 | Ga0207645_10072154 | Ga0207645_100721542 | 397 |
| 102 | 3300025926 | Ga0207659_10206764 | Ga0207659_102067642 | 397 |
| 103 | 3300025986 | Ga0207658_10094533 | Ga0207658_100945333 | 397 |
| 104 | 3300036647 | Ga0316582_0111528 | Ga0316582_0111528_344_1537 | 397 |
| 105 | 3300044712 | Ga0453684_0252379 | Ga0453684_0252379_349_1542 | 397 |
| 106 | 3300053078 | Ga0495612_0024016 | Ga0495612_0024016_713_1906 | 397 |
| 107 | 3300025910 | Ga0207684_10004380 | Ga0207684_100043802 | 398 |
| 108 | 3300044712 | Ga0453684_0008870 | Ga0453684_0008870_5449_6645 | 398 |
| 109 | 3300045051 | Ga0451576_0006776 | Ga0451576_0006776_8154_9350 | 398 |
| 110 | 3300009147 | Ga0114129_10430043 | Ga0114129_104300431 | 399 |
| 111 | 3300049569 | Ga0501032_0000206 | Ga0501032_0000206_32876_34084 | 400 |
| 112 | 3300049579 | Ga0501043_0055256 | Ga0501043_0055256_737_1945 | 400 |
| 113 | 3300049580 | Ga0501046_0000947 | Ga0501046_0000947_12097_13305 | 400 |
| 114 | 3300049581 | Ga0501047_0000322 | Ga0501047_0000322_48165_49373 | 400 |
| 115 | 3300049822 | Ga0501035_0001493 | Ga0501035_0001493_19200_20408 | 400 |
| 116 | 3300049823 | Ga0501044_0001199 | Ga0501044_0001199_25930_27138 | 400 |
| 117 | 3300005290 | Ga0065712_10027547 | Ga0065712_100275472 | 401 |
| 118 | 3300005338 | Ga0068868_100095070 | Ga0068868_1000950702 | 401 |
| 119 | 3300005364 | Ga0070673_100041338 | Ga0070673_1000413383 | 401 |
| 120 | 3300005364 | Ga0070673_100102447 | Ga0070673_1001024472 | 401 |
| 121 | 3300005440 | Ga0070705_100047394 | Ga0070705_1000473942 | 401 |
| 122 | 3300005518 | Ga0070699_100009182 | Ga0070699_1000091822 | 401 |
| 123 | 3300005536 | Ga0070697_100022275 | Ga0070697_1000222756 | 401 |
| 124 | 3300005539 | Ga0068853_100197058 | Ga0068853_1001970582 | 401 |
| 125 | 3300005549 | Ga0070704_100065237 | Ga0070704_1000652374 | 401 |
| 126 | 3300005578 | Ga0068854_100027054 | Ga0068854_1000270545 | 401 |
| 127 | 3300005614 | Ga0068856_100174574 | Ga0068856_1001745743 | 401 |
| 128 | 3300006871 | Ga0075434_100107560 | Ga0075434_1001075603 | 401 |
| 129 | 3300009147 | Ga0114129_10031572 | Ga0114129_100315722 | 401 |
| 130 | 3300013296 | Ga0157374_10149595 | Ga0157374_101495952 | 401 |
| 131 | 3300013307 | Ga0157372_10213661 | Ga0157372_102136613 | 401 |
| 132 | 3300025315 | Ga0207697_10025809 | Ga0207697_100258093 | 401 |
| 133 | 3300025901 | Ga0207688_10024098 | Ga0207688_100240983 | 401 |
| 134 | 3300025903 | Ga0207680_10036067 | Ga0207680_100360671 | 401 |
| 135 | 3300025912 | Ga0207707_10127519 | Ga0207707_101275192 | 401 |
| 136 | 3300025922 | Ga0207646_10000002 | Ga0207646_10000002484 | 401 |
| 137 | 3300025923 | Ga0207681_10083924 | Ga0207681_100839242 | 401 |
| 138 | 3300025925 | Ga0207650_10054554 | Ga0207650_100545544 | 401 |
| 139 | 3300025931 | Ga0207644_10051740 | Ga0207644_100517402 | 401 |
| 140 | 3300025933 | Ga0207706_10148619 | Ga0207706_101486192 | 401 |
| 141 | 3300025940 | Ga0207691_10076710 | Ga0207691_100767104 | 401 |
| 142 | 3300025942 | Ga0207689_10221379 | Ga0207689_102213792 | 401 |
| 143 | 3300025949 | Ga0207667_10280902 | Ga0207667_102809022 | 401 |
| 144 | 3300025981 | Ga0207640_10247194 | Ga0207640_102471941 | 401 |
| 145 | 3300025986 | Ga0207658_10321104 | Ga0207658_103211041 | 401 |
| 146 | 3300026067 | Ga0207678_10061522 | Ga0207678_100615225 | 401 |
| 147 | 3300026121 | Ga0207683_10156679 | Ga0207683_101566792 | 401 |
| 148 | 3300028379 | Ga0268266_10023848 | Ga0268266_100238484 | 401 |
| 149 | 3300028573 | Ga0265334_10005004 | Ga0265334_100050045 | 401 |
| 150 | 3300028800 | Ga0265338_10013889 | Ga0265338_100138894 | 401 |
| 151 | 3300028800 | Ga0265338_10013931 | Ga0265338_100139312 | 401 |
| 152 | 3300048905 | Ga0496102_0042350 | Ga0496102_0042350_987_2192 | 401 |
| 153 | 3300049572 | Ga0501036_0091142 | Ga0501036_0091142_977_2380 | 401 |
| 154 | 3300050507 | nmdc:mga05p37_95579_c1 | nmdc:mga05p37_95579_c1_1830_3062 | 401 |
| 155 | 3300050512 | nmdc:mga0n895_113009_c1 | nmdc:mga0n895_113009_c1_900_2105 | 401 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1c0i-assembly1.cif.gz_A | crystal structure of d-amino acid oxidase in complex with two anthranylate molecules | 0.9993 | 138 | 168 |
| 4bur-assembly3.cif.gz_C | crystal structure of the reduced human apoptosis inducing factor complexed with nad | 0.9408 | 1 | 375 |
| 5miu-assembly1.cif.gz_A | g307e variant of murine apoptosis inducing factor (oxidized state) | 0.9405 | 2 | 382 |
| 4bur-assembly4.cif.gz_D | crystal structure of the reduced human apoptosis inducing factor complexed with nad | 0.9392 | 1 | 382 |
| 5fs9-assembly1.cif.gz_A | crystal structure of the g338e mutant of human apoptosis inducing factor | 0.9377 | 1 | 382 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0JZ96_141_231_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9672 | 120 | 197 | 3.50.50.60 |
| af_Q2FZ31_2_179_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9644 | 138 | 168 | 3.50.50.60 |
| af_A0A1D6HP35_184_301_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9447 | 137 | 236 | 3.50.50.60 |
| 2bc1B02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9405 | 117 | 231 | 3.50.50.60 |
| 5jclB02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9351 | 117 | 231 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G3FVJ0-F1-model_v4 | Pyridine nucleotide-disulfide oxidoreductase | 0.9839 | 2 | 390 |
GO:0005737
GO:0012501 GO:0016174 GO:0033108 GO:0071949 |
| AF-A0A5C1A0J1-F1-model_v4 | NAD(P)/FAD-dependent oxidoreductase | 0.9746 | 2 | 388 |
GO:0005737
GO:0012501 GO:0016174 GO:0033108 GO:0046983 GO:0071949 |
| AF-A0A0Q5V9L7-F1-model_v4 | FAD/NAD(P)-binding domain-containing protein | 0.9737 | 14 | 388 |
GO:0005737
GO:0012501 GO:0016174 GO:0033108 GO:0071949 |
| AF-A0A1G3FVJ0-F1-model_v4 | Pyridine nucleotide-disulfide oxidoreductase | 0.9715 | 2 | 390 |
GO:0005737
GO:0012501 GO:0016174 GO:0033108 GO:0071949 |
| AF-A0A512L5C9-F1-model_v4 | N-acylamino acid racemase | 0.971 | 2 | 388 |
GO:0005737
GO:0012501 GO:0016174 GO:0033108 GO:0046983 GO:0071949 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar