F222306

General Info

Members Datasets Scaffolds Average Seq Length
155 107 155 396

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10000293|Ga0163163_1000029317
Length 390
Sequence MKQYKYLIIGGGMAADAAVQGIRSVDPIGEIGVISAERNPPYNRPPLSKGLWKGEPVDTIWRKTNEQNVTVHLGCTASLLDPGQKRVADTDGNSYSWEKLLLATGGSPRRFSFGGDEVIYFRTFVDYQQLRALTEKGQRFAVIGAGFIGSEIAAALAISRKEVVLIFPGQSIGEHIYPRALSQFVTDFYRQKGVELLAGEKVSGLERRGTQLAVKLSQREILVDGAVAGVGIEPNDKLGQAAGLKVENGIVVDEFLRTSHPDIYAAGDVARFFNPALGKTIRVEHEDNANTMGKLAGLNIAGKSEPYHHLPFFYSDMFELGYEAVGELDSRLETFADWKHLNKEGVIYYLHDGRVRGVLLWNVWGQVEAARKLIAEPGPFRAKDLEGRLK

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
65 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
68 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
69 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
70 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
71 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
72 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
73 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
74 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
80 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
81 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
89 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
90 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
91 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
92 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
93 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
94 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
102 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
104 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
105 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
106 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
107 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.65
Rhizosphere 99.35
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10027547 3300005290 Bacteria 2259
2 Ga0070676_10101670 3300005328 Bacteria 1777
3 Ga0070680_100001061 3300005336 Bacteria 19707
4 Ga0068868_100095070 3300005338 Bacteria 2405
5 Ga0070660_100112643 3300005339 Bacteria 2166
6 Ga0070668_100063149 3300005347 Bacteria 2870
7 Ga0070669_100025539 3300005353 Bacteria 4244
8 Ga0070675_100185752 3300005354 Bacteria 1799
9 Ga0070673_100041338 3300005364 Bacteria 3545
10 Ga0070673_100102447 3300005364 Bacteria 2360
11 Ga0070705_100002573 3300005440 Bacteria 9099
12 Ga0070705_100047394 3300005440 Bacteria 2484
13 Ga0070694_100012005 3300005444 Bacteria 5378
14 Ga0070708_100003702 3300005445 Bacteria 11987
15 Ga0070708_100020014 3300005445 Bacteria 5636
16 Ga0070708_100085645 3300005445 Bacteria 2861
17 Ga0070708_100105277 3300005445 Bacteria 2588
18 Ga0070681_10132307 3300005458 Bacteria 2426
19 Ga0070706_100012926 3300005467 Bacteria 7727
20 Ga0070706_100106699 3300005467 Bacteria 2606
21 Ga0070707_100022009 3300005468 Bacteria 6027
22 Ga0070707_100091146 3300005468 Unclassified 2951
23 Ga0070707_100371433 3300005468 Unclassified 1389
24 Ga0070698_100018022 3300005471 Bacteria 7435
25 Ga0070698_100355120 3300005471 Bacteria 1397
26 Ga0070699_100001877 3300005518 Bacteria 19007
27 Ga0070699_100009182 3300005518 Bacteria 8574
28 Ga0070697_100022275 3300005536 Bacteria 5028
29 Ga0070697_100137543 3300005536 Bacteria 2052
30 Ga0068853_100197058 3300005539 Bacteria 1832
31 Ga0070704_100031840 3300005549 Bacteria 3551
32 Ga0070704_100065237 3300005549 Bacteria 2620
33 Ga0068855_100069636 3300005563 Bacteria 4094
34 Ga0068857_100019348 3300005577 Bacteria 5977
35 Ga0068857_100068854 3300005577 Bacteria 3150
36 Ga0068854_100027054 3300005578 Bacteria 3949
37 Ga0068856_100174574 3300005614 Bacteria 2161
38 Ga0081455_10020604 3300005937 Bacteria 6203
39 Ga0075434_100107560 3300006871 Bacteria 2799
40 Ga0075434_100137344 3300006871 Bacteria 2464
41 Ga0075436_100026635 3300006914 Bacteria 3981
42 Ga0105240_10037953 3300009093 Bacteria 6185
43 Ga0105240_10351536 3300009093 Bacteria 1672
44 Ga0114129_10031572 3300009147 Bacteria 7486
45 Ga0114129_10430043 3300009147 Bacteria 1735
46 Ga0105241_10013399 3300009174 Bacteria 6010
47 Ga0105241_10022591 3300009174 Bacteria 4660
48 Ga0105237_10035486 3300009545 Bacteria 5046
49 Ga0105238_10050088 3300009551 Bacteria 4205
50 Ga0105238_10110866 3300009551 Bacteria 2724
51 Ga0105238_10167214 3300009551 Bacteria 2175
52 Ga0105249_10224548 3300009553 Bacteria 1850
53 Ga0105239_10015615 3300010375 Bacteria 8408
54 Ga0105239_10151016 3300010375 Bacteria 2592
55 Ga0157374_10149595 3300013296 Bacteria 2269
56 Ga0157378_10282655 3300013297 Bacteria 1600
57 Ga0157372_10163028 3300013307 Bacteria 2577
58 Ga0157372_10213661 3300013307 Bacteria 2235
59 Ga0163163_10000293 3300014325 Bacteria 49814
60 Ga0207697_10003359 3300025315 Bacteria 7959
61 Ga0207697_10025809 3300025315 Bacteria 2402
62 Ga0207682_10055900 3300025893 Bacteria 1642
63 Ga0207688_10024098 3300025901 Bacteria 3336
64 Ga0207680_10036067 3300025903 Bacteria 2846
65 Ga0207645_10072154 3300025907 Bacteria 2210
66 Ga0207684_10000563 3300025910 Bacteria 45289
67 Ga0207684_10004380 3300025910 Bacteria 13323
68 Ga0207684_10024410 3300025910 Bacteria 5155
69 Ga0207684_10042690 3300025910 Unclassified 3845
70 Ga0207684_10160597 3300025910 Bacteria 1935
71 Ga0207707_10056264 3300025912 Bacteria 3422
72 Ga0207707_10127519 3300025912 Bacteria 2225
73 Ga0207695_10007579 3300025913 Bacteria 13761
74 Ga0207695_10217693 3300025913 Unclassified 1818
75 Ga0207646_10000002 3300025922 Bacteria 550880
76 Ga0207646_10017511 3300025922 Bacteria 6702
77 Ga0207646_10059590 3300025922 Bacteria 3409
78 Ga0207646_10168734 3300025922 Bacteria 1976
79 Ga0207681_10083924 3300025923 Bacteria 2256
80 Ga0207681_10144601 3300025923 Bacteria 1775
81 Ga0207650_10054554 3300025925 Bacteria 2965
82 Ga0207659_10206764 3300025926 Bacteria 1571
83 Ga0207644_10051740 3300025931 Bacteria 2949
84 Ga0207706_10148619 3300025933 Bacteria 2061
85 Ga0207691_10076710 3300025940 Bacteria 3011
86 Ga0207689_10221379 3300025942 Bacteria 1564
87 Ga0207667_10255015 3300025949 Unclassified 1794
88 Ga0207667_10280902 3300025949 Bacteria 1701
89 Ga0207712_10051159 3300025961 Bacteria 2888
90 Ga0207668_10013725 3300025972 Bacteria 4998
91 Ga0207640_10247194 3300025981 Bacteria 1382
92 Ga0207658_10094533 3300025986 Bacteria 2326
93 Ga0207658_10321104 3300025986 Bacteria 1340
94 Ga0207678_10061522 3300026067 Bacteria 3229
95 Ga0207674_10015771 3300026116 Bacteria 8289
96 Ga0207674_10076535 3300026116 Bacteria 3353
97 Ga0207674_10349956 3300026116 Unclassified 1428
98 Ga0207683_10156679 3300026121 Bacteria 2057
99 Ga0268266_10023848 3300028379 Bacteria 5206
100 Ga0265334_10005004 3300028573 Bacteria 5825
101 Ga0265318_10006601 3300028577 Bacteria 5326
102 Ga0265318_10010970 3300028577 Bacteria 3924
103 Ga0265338_10013889 3300028800 Bacteria 9040
104 Ga0265338_10013931 3300028800 Bacteria 9021
105 Ga0265338_10014036 3300028800 Bacteria 8969
106 Ga0265330_10010441 3300031235 Bacteria 4377
107 Ga0265332_10003709 3300031238 Bacteria 7311
108 Ga0265320_10029087 3300031240 Bacteria 2862
109 Ga0265340_10010831 3300031247 Bacteria 4868
110 Ga0265339_10037559 3300031249 Bacteria 2706
111 Ga0265331_10003406 3300031250 Bacteria 10287
112 Ga0265316_10008877 3300031344 Bacteria 9283
113 Ga0265316_10140691 3300031344 Bacteria 1813
114 Ga0265342_10007346 3300031712 Bacteria 8084
115 Ga0307412_10014342 3300031911 Unclassified 4671
116 Ga0307409_100094718 3300031995 Bacteria 2458
117 Ga0307416_100022035 3300032002 Bacteria 4588
118 Ga0307416_100100454 3300032002 Bacteria 2516
119 Ga0307416_100371913 3300032002 Unclassified 1456
120 Ga0307415_100168218 3300032126 Unclassified 1707
121 Ga0373946_0014605 3300035171 Bacteria 2963
122 Ga0373927_0006284 3300035695 Bacteria 8105
123 Ga0316582_0111528 3300036647 Unclassified 1821
124 Ga0373925_0001245 3300037068 Bacteria 22453
125 Ga0451577_0154088 3300042876 Unclassified 2068
126 Ga0453684_0008870 3300044712 Bacteria 17816
127 Ga0453684_0173896 3300044712 Unclassified 2535
128 Ga0453684_0252379 3300044712 Bacteria 2025
129 Ga0453684_0296286 3300044712 Unclassified 1840
130 Ga0451576_0000739 3300045051 Bacteria 65393
131 Ga0451576_0006776 3300045051 Bacteria 13938
132 Ga0495662_0064453 3300046476 Unclassified 1771
133 Ga0495630_0000038 3300046517 Bacteria 113319
134 Ga0495630_0012724 3300046517 Bacteria 6114
135 Ga0495663_0011909 3300046525 Unclassified 2423
136 Ga0495586_0000011 3300046535 Bacteria 139442
137 Ga0495635_0029217 3300046663 Bacteria 3833
138 Ga0495657_0020300 3300046675 Bacteria 4779
139 Ga0495674_0017586 3300047319 Bacteria 6656
140 Ga0495676_0029618 3300047321 Bacteria 4660
141 Ga0495680_0131499 3300047322 Bacteria 1838
142 Ga0496102_0042350 3300048905 Bacteria 4126
143 Ga0501032_0000206 3300049569 Bacteria 49241
144 Ga0501036_0091142 3300049572 Bacteria 2575
145 Ga0501043_0055256 3300049579 Bacteria 3119
146 Ga0501046_0000947 3300049580 Bacteria 28449
147 Ga0501047_0000322 3300049581 Bacteria 55407
148 Ga0501070_0035941 3300049586 Bacteria 4137
149 Ga0501035_0001493 3300049822 Bacteria 23956
150 Ga0501044_0000129 3300049823 Bacteria 92557
151 Ga0501044_0001199 3300049823 Bacteria 30731
152 nmdc:mga05p37_95579_c1 3300050507 Bacteria 3661
153 nmdc:mga0n895_113009_c1 3300050512 Bacteria 2733
154 nmdc:mga08x19_233264_c1 3300050514 Bacteria 1267
155 Ga0495612_0024016 3300053078 Bacteria 2448

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009551 Ga0105238_10167214 Ga0105238_101672142 379
2 3300050514 nmdc:mga08x19_233264_c1 nmdc:mga08x19_233264_c1_116_1255 379
3 3300005445 Ga0070708_100020014 Ga0070708_1000200145 382
4 3300005467 Ga0070706_100106699 Ga0070706_1001066993 382
5 3300025910 Ga0207684_10024410 Ga0207684_100244106 382
6 3300005336 Ga0070680_100001061 Ga0070680_10000106110 384
7 3300005444 Ga0070694_100012005 Ga0070694_1000120053 384
8 3300013307 Ga0157372_10163028 Ga0157372_101630282 386
9 3300005353 Ga0070669_100025539 Ga0070669_1000255393 389
10 3300009551 Ga0105238_10050088 Ga0105238_100500882 389
11 3300025315 Ga0207697_10003359 Ga0207697_100033596 389
12 3300025923 Ga0207681_10144601 Ga0207681_101446012 389
13 3300025972 Ga0207668_10013725 Ga0207668_100137253 389
14 3300046663 Ga0495635_0029217 Ga0495635_0029217_1245_2414 389
15 3300046675 Ga0495657_0020300 Ga0495657_0020300_3600_4769 389
16 3300047322 Ga0495680_0131499 Ga0495680_0131499_432_1601 389
17 3300014325 Ga0163163_10000293 Ga0163163_1000029317 390
18 3300005468 Ga0070707_100022009 Ga0070707_1000220095 391
19 3300005468 Ga0070707_100371433 Ga0070707_1003714331 391
20 3300005471 Ga0070698_100355120 Ga0070698_1003551201 391
21 3300005518 Ga0070699_100001877 Ga0070699_1000018771 391
22 3300006871 Ga0075434_100137344 Ga0075434_1001373441 391
23 3300009093 Ga0105240_10037953 Ga0105240_100379536 391
24 3300009553 Ga0105249_10224548 Ga0105249_102245482 391
25 3300025910 Ga0207684_10000563 Ga0207684_1000056340 391
26 3300025910 Ga0207684_10160597 Ga0207684_101605971 391
27 3300025913 Ga0207695_10217693 Ga0207695_102176932 391
28 3300025922 Ga0207646_10017511 Ga0207646_100175115 391
29 3300025949 Ga0207667_10255015 Ga0207667_102550151 391
30 3300025961 Ga0207712_10051159 Ga0207712_100511592 391
31 3300046525 Ga0495663_0011909 Ga0495663_0011909_1078_2253 391
32 3300005339 Ga0070660_100112643 Ga0070660_1001126431 392
33 3300005440 Ga0070705_100002573 Ga0070705_1000025738 392
34 3300005445 Ga0070708_100003702 Ga0070708_1000037022 392
35 3300005445 Ga0070708_100105277 Ga0070708_1001052771 392
36 3300005458 Ga0070681_10132307 Ga0070681_101323072 392
37 3300005536 Ga0070697_100137543 Ga0070697_1001375432 392
38 3300005549 Ga0070704_100031840 Ga0070704_1000318402 392
39 3300005563 Ga0068855_100069636 Ga0068855_1000696362 392
40 3300005577 Ga0068857_100068854 Ga0068857_1000688545 392
41 3300009093 Ga0105240_10351536 Ga0105240_103515362 392
42 3300009174 Ga0105241_10013399 Ga0105241_100133994 392
43 3300009174 Ga0105241_10022591 Ga0105241_100225912 392
44 3300009545 Ga0105237_10035486 Ga0105237_100354867 392
45 3300009551 Ga0105238_10110866 Ga0105238_101108663 392
46 3300010375 Ga0105239_10015615 Ga0105239_100156152 392
47 3300010375 Ga0105239_10151016 Ga0105239_101510162 392
48 3300025912 Ga0207707_10056264 Ga0207707_100562643 392
49 3300026116 Ga0207674_10015771 Ga0207674_100157714 392
50 3300026116 Ga0207674_10076535 Ga0207674_100765352 392
51 3300032002 Ga0307416_100100454 Ga0307416_1001004544 392
52 3300044712 Ga0453684_0296286 Ga0453684_0296286_454_1632 392
53 3300045051 Ga0451576_0000739 Ga0451576_0000739_62302_63480 392
54 3300049586 Ga0501070_0035941 Ga0501070_0035941_933_2114 392
55 3300049823 Ga0501044_0000129 Ga0501044_0000129_60566_61744 392
56 3300006914 Ga0075436_100026635 Ga0075436_1000266352 393
57 3300028577 Ga0265318_10006601 Ga0265318_100066015 393
58 3300028800 Ga0265338_10014036 Ga0265338_100140366 393
59 3300031240 Ga0265320_10029087 Ga0265320_100290873 393
60 3300031247 Ga0265340_10010831 Ga0265340_100108314 393
61 3300031344 Ga0265316_10140691 Ga0265316_101406912 393
62 3300031911 Ga0307412_10014342 Ga0307412_100143425 393
63 3300032002 Ga0307416_100022035 Ga0307416_1000220353 393
64 3300005445 Ga0070708_100085645 Ga0070708_1000856452 394
65 3300005467 Ga0070706_100012926 Ga0070706_1000129262 394
66 3300005468 Ga0070707_100091146 Ga0070707_1000911462 394
67 3300005471 Ga0070698_100018022 Ga0070698_1000180222 394
68 3300005577 Ga0068857_100019348 Ga0068857_1000193481 394
69 3300025910 Ga0207684_10042690 Ga0207684_100426902 394
70 3300025913 Ga0207695_10007579 Ga0207695_100075798 394
71 3300025922 Ga0207646_10059590 Ga0207646_100595904 394
72 3300025922 Ga0207646_10168734 Ga0207646_101687342 394
73 3300026116 Ga0207674_10349956 Ga0207674_103499561 394
74 3300032002 Ga0307416_100371913 Ga0307416_1003719132 394
75 3300035171 Ga0373946_0014605 Ga0373946_0014605_807_1994 394
76 3300035695 Ga0373927_0006284 Ga0373927_0006284_1563_2750 394
77 3300037068 Ga0373925_0001245 Ga0373925_0001245_3194_4381 394
78 3300042876 Ga0451577_0154088 Ga0451577_0154088_739_1923 394
79 3300044712 Ga0453684_0173896 Ga0453684_0173896_1123_2307 394
80 3300046476 Ga0495662_0064453 Ga0495662_0064453_47_1231 394
81 3300046517 Ga0495630_0000038 Ga0495630_0000038_4770_5954 394
82 3300046517 Ga0495630_0012724 Ga0495630_0012724_1280_2467 394
83 3300046535 Ga0495586_0000011 Ga0495586_0000011_3114_4298 394
84 3300047319 Ga0495674_0017586 Ga0495674_0017586_233_1417 394
85 3300047321 Ga0495676_0029618 Ga0495676_0029618_1229_2413 394
86 3300005937 Ga0081455_10020604 Ga0081455_100206044 396
87 3300028577 Ga0265318_10010970 Ga0265318_100109703 396
88 3300031235 Ga0265330_10010441 Ga0265330_100104412 396
89 3300031238 Ga0265332_10003709 Ga0265332_100037093 396
90 3300031249 Ga0265339_10037559 Ga0265339_100375592 396
91 3300031250 Ga0265331_10003406 Ga0265331_100034069 396
92 3300031344 Ga0265316_10008877 Ga0265316_100088777 396
93 3300031712 Ga0265342_10007346 Ga0265342_100073466 396
94 3300031995 Ga0307409_100094718 Ga0307409_1000947182 396
95 3300032126 Ga0307415_100168218 Ga0307415_1001682182 396
96 3300005328 Ga0070676_10101670 Ga0070676_101016702 397
97 3300005347 Ga0070668_100063149 Ga0070668_1000631491 397
98 3300005354 Ga0070675_100185752 Ga0070675_1001857522 397
99 3300013297 Ga0157378_10282655 Ga0157378_102826552 397
100 3300025893 Ga0207682_10055900 Ga0207682_100559002 397
101 3300025907 Ga0207645_10072154 Ga0207645_100721542 397
102 3300025926 Ga0207659_10206764 Ga0207659_102067642 397
103 3300025986 Ga0207658_10094533 Ga0207658_100945333 397
104 3300036647 Ga0316582_0111528 Ga0316582_0111528_344_1537 397
105 3300044712 Ga0453684_0252379 Ga0453684_0252379_349_1542 397
106 3300053078 Ga0495612_0024016 Ga0495612_0024016_713_1906 397
107 3300025910 Ga0207684_10004380 Ga0207684_100043802 398
108 3300044712 Ga0453684_0008870 Ga0453684_0008870_5449_6645 398
109 3300045051 Ga0451576_0006776 Ga0451576_0006776_8154_9350 398
110 3300009147 Ga0114129_10430043 Ga0114129_104300431 399
111 3300049569 Ga0501032_0000206 Ga0501032_0000206_32876_34084 400
112 3300049579 Ga0501043_0055256 Ga0501043_0055256_737_1945 400
113 3300049580 Ga0501046_0000947 Ga0501046_0000947_12097_13305 400
114 3300049581 Ga0501047_0000322 Ga0501047_0000322_48165_49373 400
115 3300049822 Ga0501035_0001493 Ga0501035_0001493_19200_20408 400
116 3300049823 Ga0501044_0001199 Ga0501044_0001199_25930_27138 400
117 3300005290 Ga0065712_10027547 Ga0065712_100275472 401
118 3300005338 Ga0068868_100095070 Ga0068868_1000950702 401
119 3300005364 Ga0070673_100041338 Ga0070673_1000413383 401
120 3300005364 Ga0070673_100102447 Ga0070673_1001024472 401
121 3300005440 Ga0070705_100047394 Ga0070705_1000473942 401
122 3300005518 Ga0070699_100009182 Ga0070699_1000091822 401
123 3300005536 Ga0070697_100022275 Ga0070697_1000222756 401
124 3300005539 Ga0068853_100197058 Ga0068853_1001970582 401
125 3300005549 Ga0070704_100065237 Ga0070704_1000652374 401
126 3300005578 Ga0068854_100027054 Ga0068854_1000270545 401
127 3300005614 Ga0068856_100174574 Ga0068856_1001745743 401
128 3300006871 Ga0075434_100107560 Ga0075434_1001075603 401
129 3300009147 Ga0114129_10031572 Ga0114129_100315722 401
130 3300013296 Ga0157374_10149595 Ga0157374_101495952 401
131 3300013307 Ga0157372_10213661 Ga0157372_102136613 401
132 3300025315 Ga0207697_10025809 Ga0207697_100258093 401
133 3300025901 Ga0207688_10024098 Ga0207688_100240983 401
134 3300025903 Ga0207680_10036067 Ga0207680_100360671 401
135 3300025912 Ga0207707_10127519 Ga0207707_101275192 401
136 3300025922 Ga0207646_10000002 Ga0207646_10000002484 401
137 3300025923 Ga0207681_10083924 Ga0207681_100839242 401
138 3300025925 Ga0207650_10054554 Ga0207650_100545544 401
139 3300025931 Ga0207644_10051740 Ga0207644_100517402 401
140 3300025933 Ga0207706_10148619 Ga0207706_101486192 401
141 3300025940 Ga0207691_10076710 Ga0207691_100767104 401
142 3300025942 Ga0207689_10221379 Ga0207689_102213792 401
143 3300025949 Ga0207667_10280902 Ga0207667_102809022 401
144 3300025981 Ga0207640_10247194 Ga0207640_102471941 401
145 3300025986 Ga0207658_10321104 Ga0207658_103211041 401
146 3300026067 Ga0207678_10061522 Ga0207678_100615225 401
147 3300026121 Ga0207683_10156679 Ga0207683_101566792 401
148 3300028379 Ga0268266_10023848 Ga0268266_100238484 401
149 3300028573 Ga0265334_10005004 Ga0265334_100050045 401
150 3300028800 Ga0265338_10013889 Ga0265338_100138894 401
151 3300028800 Ga0265338_10013931 Ga0265338_100139312 401
152 3300048905 Ga0496102_0042350 Ga0496102_0042350_987_2192 401
153 3300049572 Ga0501036_0091142 Ga0501036_0091142_977_2380 401
154 3300050507 nmdc:mga05p37_95579_c1 nmdc:mga05p37_95579_c1_1830_3062 401
155 3300050512 nmdc:mga0n895_113009_c1 nmdc:mga0n895_113009_c1_900_2105 401

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

139

220

0.93

PF14721

AIF_C

Apoptosis-inducing factor, mitochondrion-associated, C-term

336

376

0.92

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

4

293

0.91

PF14721

AIF_C

Apoptosis-inducing factor, mitochondrion-associated, C-term

296

344

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1c0i-assembly1.cif.gz_A crystal structure of d-amino acid oxidase in complex with two anthranylate molecules 0.9993 138 168
4bur-assembly3.cif.gz_C crystal structure of the reduced human apoptosis inducing factor complexed with nad 0.9408 1 375
5miu-assembly1.cif.gz_A g307e variant of murine apoptosis inducing factor (oxidized state) 0.9405 2 382
4bur-assembly4.cif.gz_D crystal structure of the reduced human apoptosis inducing factor complexed with nad 0.9392 1 382
5fs9-assembly1.cif.gz_A crystal structure of the g338e mutant of human apoptosis inducing factor 0.9377 1 382
ID Description Score Start End Superfamily
af_A0A0R0JZ96_141_231_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9672 120 197 3.50.50.60
af_Q2FZ31_2_179_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9644 138 168 3.50.50.60
af_A0A1D6HP35_184_301_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9447 137 236 3.50.50.60
2bc1B02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9405 117 231 3.50.50.60
5jclB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9351 117 231 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A1G3FVJ0-F1-model_v4 Pyridine nucleotide-disulfide oxidoreductase 0.9839 2 390 GO:0005737
GO:0012501
GO:0016174
GO:0033108
GO:0071949
AF-A0A5C1A0J1-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9746 2 388 GO:0005737
GO:0012501
GO:0016174
GO:0033108
GO:0046983
GO:0071949
AF-A0A0Q5V9L7-F1-model_v4 FAD/NAD(P)-binding domain-containing protein 0.9737 14 388 GO:0005737
GO:0012501
GO:0016174
GO:0033108
GO:0071949
AF-A0A1G3FVJ0-F1-model_v4 Pyridine nucleotide-disulfide oxidoreductase 0.9715 2 390 GO:0005737
GO:0012501
GO:0016174
GO:0033108
GO:0071949
AF-A0A512L5C9-F1-model_v4 N-acylamino acid racemase 0.971 2 388 GO:0005737
GO:0012501
GO:0016174
GO:0033108
GO:0046983
GO:0071949

Feature Viewer

pLDDT pTM Quality
93.06 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map