F222223

General Info

Members Datasets Scaffolds Average Seq Length
155 98 153 138

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10163845|Ga0105246_101638451
Length 153
Sequence MRRTIGVMLVVAIVLDLLYWTLWFTQRDWIASEHSHAYYEFENAFPLADLWLGVACVLALVTLRARRPSALLWLVCAGSAGLYLFGMDFLYDVENGIFAKGGGGAFEAVIVALTLAFSITLLSWSWRHRGELLSGYQRDQRDQNPSSGAETGR

Samples

Sample ID Description Type Environment
1 2643221615 Nocardioides sp. Root224 Isolate Unclassified
2 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
31 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
45 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
48 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
49 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
50 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
51 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
52 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
53 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
54 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
55 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
56 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
57 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
58 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
59 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
60 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
61 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
62 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
63 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
64 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
65 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
66 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
67 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
68 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
69 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
70 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
80 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
81 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
82 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
83 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
84 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
85 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
87 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
88 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
89 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
90 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
91 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
92 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
93 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
94 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
95 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
96 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
97 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
98 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 0
Isolates 1.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 38.06
Nodule 0
Rhizoplane 2.58
Rhizosphere 54.19
Stem 0
Stem Tuber 0
Unclassified 5.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10328831 3300003322 Bacteria 1273
2 Ga0070658_10388992 3300005327 Bacteria 1197
3 Ga0070658_11408403 3300005327 Bacteria 605
4 Ga0070683_100230113 3300005329 Bacteria 1762
5 Ga0070683_100631932 3300005329 Bacteria 1025
6 Ga0070670_101149071 3300005331 Bacteria 709
7 Ga0070660_100249316 3300005339 Bacteria 1448
8 Ga0070660_100674527 3300005339 Bacteria 866
9 Ga0070675_100973904 3300005354 Bacteria 778
10 Ga0070659_100004058 3300005366 Bacteria 10441
11 Ga0070659_100724839 3300005366 Bacteria 861
12 Ga0070667_100679000 3300005367 Bacteria 952
13 Ga0070662_100584753 3300005457 Unclassified 938
14 Ga0070672_100289644 3300005543 Bacteria 1386
15 Ga0068855_100309834 3300005563 Bacteria 1747
16 Ga0070664_100014667 3300005564 Bacteria 6398
17 Ga0068856_101589617 3300005614 Unclassified 667
18 Ga0068866_10293049 3300005718 Bacteria 1013
19 Ga0068860_100000408 3300005843 Bacteria 55871
20 Ga0068862_101997009 3300005844 Bacteria 591
21 Ga0075365_10033289 3300006038 Bacteria 3320
22 Ga0075365_10097796 3300006038 Bacteria 2007
23 Ga0075365_10198670 3300006038 Bacteria 1405
24 Ga0075365_10235639 3300006038 Bacteria 1285
25 Ga0075365_10256439 3300006038 Bacteria 1229
26 Ga0075365_10264089 3300006038 Bacteria 1210
27 Ga0075365_10295679 3300006038 Bacteria 1139
28 Ga0075365_10317535 3300006038 Bacteria 1097
29 Ga0075365_10338852 3300006038 Bacteria 1060
30 Ga0075365_10595794 3300006038 Bacteria 782
31 Ga0075365_10724018 3300006038 Bacteria 703
32 Ga0075365_10782467 3300006038 Bacteria 673
33 Ga0075368_10024000 3300006042 Bacteria 2333
34 Ga0075368_10057811 3300006042 Bacteria 1549
35 Ga0075363_100052866 3300006048 Bacteria 2169
36 Ga0075363_100069027 3300006048 Bacteria 1917
37 Ga0075363_100132599 3300006048 Bacteria 1398
38 Ga0075363_100143823 3300006048 Bacteria 1344
39 Ga0075363_100297980 3300006048 Bacteria 935
40 Ga0075363_100451180 3300006048 Bacteria 760
41 Ga0075364_10066028 3300006051 Bacteria 2376
42 Ga0075367_10034543 3300006178 Bacteria 2922
43 Ga0075367_10082502 3300006178 Bacteria 1946
44 Ga0075367_10329401 3300006178 Bacteria 963
45 Ga0075367_10424486 3300006178 Bacteria 842
46 Ga0075370_10015688 3300006353 Bacteria 4062
47 Ga0075370_10247840 3300006353 Bacteria 1055
48 Ga0075370_10461735 3300006353 Bacteria 764
49 Ga0105249_11876754 3300009553 Bacteria 672
50 Ga0105239_10085110 3300010375 Bacteria 3484
51 Ga0105239_12455220 3300010375 Bacteria 607
52 Ga0105246_10163845 3300011119 Bacteria 1696
53 Ga0157369_10497891 3300013105 Bacteria 1261
54 Ga0157375_10658890 3300013308 Bacteria 1203
55 Ga0157375_10976212 3300013308 Bacteria 988
56 Ga0163161_10333800 3300017792 Bacteria 1201
57 Ga0207647_10031808 3300025904 Bacteria 3394
58 Ga0207657_10174730 3300025919 Bacteria 1739
59 Ga0207657_10341275 3300025919 Bacteria 1182
60 Ga0207690_10035472 3300025932 Bacteria 3222
61 Ga0207690_10502616 3300025932 Bacteria 981
62 Ga0207691_10150376 3300025940 Bacteria 2047
63 Ga0207689_10903610 3300025942 Bacteria 745
64 Ga0207661_10194238 3300025944 Bacteria 1781
65 Ga0207679_10039306 3300025945 Bacteria 3377
66 Ga0207679_10388299 3300025945 Bacteria 1225
67 Ga0207712_10285025 3300025961 Bacteria 1349
68 Ga0207658_10255004 3300025986 Bacteria 1492
69 Ga0207678_10063529 3300026067 Bacteria 3173
70 Ga0207708_11668641 3300026075 Bacteria 560
71 Ga0207674_10339492 3300026116 Bacteria 1452
72 Ga0207683_10459935 3300026121 Bacteria 1174
73 Ga0209813_10088968 3300027866 Bacteria 1033
74 Ga0268265_12284059 3300028380 Bacteria 548
75 Ga0268264_10000462 3300028381 Bacteria 55077
76 Ga0307405_10759216 3300031731 Bacteria 809
77 Ga0307410_10850339 3300031852 Bacteria 779
78 Ga0307412_11065272 3300031911 Bacteria 718
79 Ga0307409_100335794 3300031995 Bacteria 1420
80 Ga0307411_12065245 3300032005 Bacteria 533
81 Ga0307411_12110223 3300032005 Unclassified 527
82 Ga0436364_1006023 3300037853 Bacteria 656
83 Ga0395901_1291455 3300038443 Bacteria 692
84 Ga0436365_1753171 3300039437 Bacteria 552
85 Ga0451789_0092772 3300041443 Bacteria 867
86 Ga0451804_0737108 3300041463 Bacteria 568
87 Ga0451835_0247326 3300041492 Bacteria 585
88 Ga0451843_1093101 3300041509 Bacteria 1099
89 Ga0439464_0007364 3300042439 Bacteria 2879
90 Ga0466972_0232051 3300044658 Bacteria 863
91 Ga0466964_0035815 3300044706 Bacteria 1987
92 Ga0466960_0041349 3300044901 Bacteria 2184
93 Ga0466960_0587335 3300044901 Bacteria 660
94 Ga0495608_0480630 3300046511 Bacteria 754
95 Ga0495674_0597849 3300047319 Bacteria 874
96 Ga0496110_0365724 3300048913 Bacteria 1314
97 Ga0496114_0084580 3300048917 Bacteria 2686
98 Ga0496124_0577597 3300048927 Bacteria 736
99 Ga0501031_0002956 3300049568 Bacteria 10874
100 Ga0501032_0014599 3300049569 Bacteria 5563
101 Ga0501033_0000644 3300049570 Bacteria 32304
102 Ga0501036_0026314 3300049572 Bacteria 4910
103 Ga0501037_0045738 3300049573 Bacteria 3212
104 Ga0501037_0769762 3300049573 Bacteria 637
105 Ga0501038_0026423 3300049574 Bacteria 5171
106 Ga0501039_0003491 3300049575 Bacteria 11757
107 Ga0501043_0011889 3300049579 Bacteria 6817
108 Ga0501043_0044305 3300049579 Bacteria 3498
109 Ga0501046_0000383 3300049580 Bacteria 44303
110 Ga0501046_0012189 3300049580 Bacteria 7327
111 Ga0501047_0379696 3300049581 Bacteria 1247
112 Ga0501048_0077701 3300049582 Bacteria 2342
113 Ga0501067_0266468 3300049583 Bacteria 954
114 Ga0501068_0091893 3300049584 Bacteria 1873
115 Ga0501070_0005001 3300049586 Bacteria 11313
116 Ga0501070_0738092 3300049586 Bacteria 777
117 Ga0501071_0373252 3300049587 Bacteria 1087
118 Ga0501073_0051203 3300049589 Bacteria 2893
119 Ga0501080_0150885 3300049742 Bacteria 2148
120 Ga0501035_0257116 3300049822 Bacteria 1481
121 Ga0501044_0318028 3300049823 Bacteria 1481
122 Ga0501044_1304700 3300049823 Bacteria 592
123 nmdc:mga03n38_40427_c1 3300050490 Bacteria 2027
124 nmdc:mga03n38_560384_c1 3300050490 Bacteria 647
125 nmdc:mga03n38_642915_c1 3300050490 Bacteria 607
126 nmdc:mga03n38_78410_c1 3300050490 Bacteria 1546
127 nmdc:mga00v17_384829_c1 3300050491 Bacteria 912
128 nmdc:mga00v17_601037_c1 3300050491 Bacteria 709
129 nmdc:mga0yw44_182058_c1 3300050492 Bacteria 1383
130 nmdc:mga0yw44_193290_c1 3300050492 Bacteria 1343
131 nmdc:mga0yw44_231373_c1 3300050492 Bacteria 1227
132 nmdc:mga0yw44_243028_c1 3300050492 Bacteria 1197
133 nmdc:mga0yw44_286560_c1 3300050492 Bacteria 1102
134 nmdc:mga0yw44_290706_c1 3300050492 Bacteria 1094
135 nmdc:mga0yw44_292243_c1 3300050492 Bacteria 1091
136 nmdc:mga0yw44_395850_c1 3300050492 Bacteria 934
137 nmdc:mga0yw44_63151_c1 3300050492 Bacteria 2277
138 nmdc:mga0yw44_801013_c1 3300050492 Bacteria 640
139 nmdc:mga06z11_58580_c1 3300050494 Bacteria 1999
140 nmdc:mga06z11_68784_c1 3300050494 Bacteria 1867
141 nmdc:mga04h51_68528_c1 3300050495 Bacteria 1233
142 nmdc:mga07m45_204521_c1 3300050496 Bacteria 1149
143 nmdc:mga07m45_217637_c1 3300050496 Bacteria 1111
144 nmdc:mga07m45_306029_c1 3300050496 Bacteria 924
145 nmdc:mga07m45_32933_c1 3300050496 Bacteria 2876
146 Ga0495619_0626842 3300053085 Bacteria 735
147 Ga0500644_0000324 3300053088 Bacteria 24882
148 Ga0500644_0114770 3300053088 Bacteria 1042
149 Ga0500554_033469 3300053102 Bacteria 1533
150 Ga0500593_000333 3300053117 Bacteria 18969
151 Ga0500568_0264403 3300053139 Bacteria 626
152 Ga0500573_0002382 3300053140 Bacteria 9367
153 Ga0500573_0089119 3300053140 Bacteria 1745

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006048 Ga0075363_100297980 Ga0075363_1002979802 126
2 3300049587 Ga0501071_0373252 Ga0501071_0373252_399_779 126
3 3300050490 nmdc:mga03n38_642915_c1 nmdc:mga03n38_642915_c1_200_580 126
4 3300053139 Ga0500568_0264403 Ga0500568_0264403_222_602 126
5 3300005331 Ga0070670_101149071 Ga0070670_1011490711 128
6 3300005354 Ga0070675_100973904 Ga0070675_1009739041 128
7 3300005543 Ga0070672_100289644 Ga0070672_1002896441 128
8 3300005844 Ga0068862_101997009 Ga0068862_1019970091 128
9 3300013308 Ga0157375_10976212 Ga0157375_109762122 128
10 3300025940 Ga0207691_10150376 Ga0207691_101503763 128
11 3300026075 Ga0207708_11668641 Ga0207708_116686411 128
12 3300028380 Ga0268265_12284059 Ga0268265_122840591 128
13 3300032005 Ga0307411_12110223 Ga0307411_121102231 128
14 3300049584 Ga0501068_0091893 Ga0501068_0091893_1407_1823 130
15 3300053140 Ga0500573_0002382 Ga0500573_0002382_1322_1714 130
16 3300005327 Ga0070658_10388992 Ga0070658_103889922 131
17 3300044901 Ga0466960_0587335 Ga0466960_0587335_105_503 132
18 3300049570 Ga0501033_0000644 Ga0501033_0000644_30201_30614 132
19 3300049573 Ga0501037_0769762 Ga0501037_0769762_158_571 132
20 3300049579 Ga0501043_0044305 Ga0501043_0044305_2300_2713 132
21 3300049580 Ga0501046_0000383 Ga0501046_0000383_17788_18201 132
22 3300049823 Ga0501044_1304700 Ga0501044_1304700_154_567 132
23 3300013308 Ga0157375_10658890 Ga0157375_106588902 133
24 3300017792 Ga0163161_10333800 Ga0163161_103338002 133
25 3300025942 Ga0207689_10903610 Ga0207689_109036101 133
26 3300037853 Ga0436364_1006023 Ga0436364_1006023_200_601 133
27 3300053117 Ga0500593_000333 Ga0500593_000333_11729_12130 133
28 iso_pu_bacteria 2643221615 2644093474 133
29 iso_pu_bacteria 2643221657 2644323084 133
30 3300048927 Ga0496124_0577597 Ga0496124_0577597_73_477 134
31 3300053085 Ga0495619_0626842 Ga0495619_0626842_168_578 135
32 3300006038 Ga0075365_10724018 Ga0075365_107240182 137
33 3300049568 Ga0501031_0002956 Ga0501031_0002956_9170_9583 137
34 3300049569 Ga0501032_0014599 Ga0501032_0014599_1171_1584 137
35 3300049572 Ga0501036_0026314 Ga0501036_0026314_1881_2294 137
36 3300049573 Ga0501037_0045738 Ga0501037_0045738_1829_2242 137
37 3300049574 Ga0501038_0026423 Ga0501038_0026423_3252_3665 137
38 3300049575 Ga0501039_0003491 Ga0501039_0003491_6680_7093 137
39 3300049579 Ga0501043_0011889 Ga0501043_0011889_3402_3815 137
40 3300049580 Ga0501046_0012189 Ga0501046_0012189_183_596 137
41 3300049581 Ga0501047_0379696 Ga0501047_0379696_183_596 137
42 3300049582 Ga0501048_0077701 Ga0501048_0077701_1102_1515 137
43 3300049586 Ga0501070_0005001 Ga0501070_0005001_7260_7673 137
44 3300049589 Ga0501073_0051203 Ga0501073_0051203_451_864 137
45 3300049742 Ga0501080_0150885 Ga0501080_0150885_90_503 137
46 3300049822 Ga0501035_0257116 Ga0501035_0257116_654_1067 137
47 3300049823 Ga0501044_0318028 Ga0501044_0318028_415_828 137
48 3300005366 Ga0070659_100724839 Ga0070659_1007248392 138
49 3300005564 Ga0070664_100014667 Ga0070664_1000146677 138
50 3300005718 Ga0068866_10293049 Ga0068866_102930492 138
51 3300005843 Ga0068860_100000408 Ga0068860_1000004088 138
52 3300006038 Ga0075365_10033289 Ga0075365_100332892 138
53 3300006038 Ga0075365_10097796 Ga0075365_100977962 138
54 3300006038 Ga0075365_10235639 Ga0075365_102356392 138
55 3300006038 Ga0075365_10295679 Ga0075365_102956792 138
56 3300006038 Ga0075365_10317535 Ga0075365_103175352 138
57 3300006038 Ga0075365_10338852 Ga0075365_103388522 138
58 3300006038 Ga0075365_10595794 Ga0075365_105957942 138
59 3300006038 Ga0075365_10782467 Ga0075365_107824672 138
60 3300006042 Ga0075368_10024000 Ga0075368_100240002 138
61 3300006042 Ga0075368_10057811 Ga0075368_100578112 138
62 3300006048 Ga0075363_100052866 Ga0075363_1000528663 138
63 3300006048 Ga0075363_100069027 Ga0075363_1000690272 138
64 3300006048 Ga0075363_100143823 Ga0075363_1001438232 138
65 3300006048 Ga0075363_100451180 Ga0075363_1004511802 138
66 3300006051 Ga0075364_10066028 Ga0075364_100660283 138
67 3300006178 Ga0075367_10034543 Ga0075367_100345432 138
68 3300006178 Ga0075367_10329401 Ga0075367_103294012 138
69 3300006178 Ga0075367_10424486 Ga0075367_104244862 138
70 3300006353 Ga0075370_10015688 Ga0075370_100156885 138
71 3300006353 Ga0075370_10247840 Ga0075370_102478402 138
72 3300006353 Ga0075370_10461735 Ga0075370_104617351 138
73 3300009553 Ga0105249_11876754 Ga0105249_118767542 138
74 3300025932 Ga0207690_10502616 Ga0207690_105026162 138
75 3300025945 Ga0207679_10039306 Ga0207679_100393062 138
76 3300026067 Ga0207678_10063529 Ga0207678_100635294 138
77 3300026116 Ga0207674_10339492 Ga0207674_103394922 138
78 3300026121 Ga0207683_10459935 Ga0207683_104599352 138
79 3300027866 Ga0209813_10088968 Ga0209813_100889682 138
80 3300028381 Ga0268264_10000462 Ga0268264_1000046242 138
81 3300031852 Ga0307410_10850339 Ga0307410_108503392 138
82 3300031995 Ga0307409_100335794 Ga0307409_1003357942 138
83 3300032005 Ga0307411_12065245 Ga0307411_120652451 138
84 3300038443 Ga0395901_1291455 Ga0395901_1291455_202_618 138
85 3300041463 Ga0451804_0737108 Ga0451804_0737108_131_547 138
86 3300041492 Ga0451835_0247326 Ga0451835_0247326_133_552 138
87 3300041509 Ga0451843_1093101 Ga0451843_1093101_443_859 138
88 3300049586 Ga0501070_0738092 Ga0501070_0738092_202_618 138
89 3300050490 nmdc:mga03n38_40427_c1 nmdc:mga03n38_40427_c1_582_998 138
90 3300050490 nmdc:mga03n38_560384_c1 nmdc:mga03n38_560384_c1_127_543 138
91 3300050491 nmdc:mga00v17_384829_c1 nmdc:mga00v17_384829_c1_280_696 138
92 3300050491 nmdc:mga00v17_601037_c1 nmdc:mga00v17_601037_c1_48_464 138
93 3300050492 nmdc:mga0yw44_182058_c1 nmdc:mga0yw44_182058_c1_442_858 138
94 3300050492 nmdc:mga0yw44_193290_c1 nmdc:mga0yw44_193290_c1_214_630 138
95 3300050492 nmdc:mga0yw44_243028_c1 nmdc:mga0yw44_243028_c1_753_1169 138
96 3300050492 nmdc:mga0yw44_286560_c1 nmdc:mga0yw44_286560_c1_424_840 138
97 3300050492 nmdc:mga0yw44_290706_c1 nmdc:mga0yw44_290706_c1_327_743 138
98 3300050492 nmdc:mga0yw44_395850_c1 nmdc:mga0yw44_395850_c1_428_844 138
99 3300050492 nmdc:mga0yw44_63151_c1 nmdc:mga0yw44_63151_c1_1093_1509 138
100 3300050492 nmdc:mga0yw44_801013_c1 nmdc:mga0yw44_801013_c1_112_528 138
101 3300050494 nmdc:mga06z11_58580_c1 nmdc:mga06z11_58580_c1_368_784 138
102 3300050495 nmdc:mga04h51_68528_c1 nmdc:mga04h51_68528_c1_418_834 138
103 3300050496 nmdc:mga07m45_204521_c1 nmdc:mga07m45_204521_c1_221_637 138
104 3300050496 nmdc:mga07m45_217637_c1 nmdc:mga07m45_217637_c1_357_773 138
105 3300050496 nmdc:mga07m45_306029_c1 nmdc:mga07m45_306029_c1_73_489 138
106 3300050496 nmdc:mga07m45_32933_c1 nmdc:mga07m45_32933_c1_1630_2046 138
107 3300053088 Ga0500644_0000324 Ga0500644_0000324_24432_24848 138
108 3300053088 Ga0500644_0114770 Ga0500644_0114770_535_951 138
109 3300053102 Ga0500554_033469 Ga0500554_033469_1056_1472 138
110 3300053140 Ga0500573_0089119 Ga0500573_0089119_27_443 138
111 3300005329 Ga0070683_100631932 Ga0070683_1006319322 139
112 3300005339 Ga0070660_100249316 Ga0070660_1002493162 139
113 3300005366 Ga0070659_100004058 Ga0070659_1000040584 139
114 3300005563 Ga0068855_100309834 Ga0068855_1003098343 139
115 3300006038 Ga0075365_10256439 Ga0075365_102564392 139
116 3300006048 Ga0075363_100132599 Ga0075363_1001325992 139
117 3300006178 Ga0075367_10082502 Ga0075367_100825023 139
118 3300010375 Ga0105239_10085110 Ga0105239_100851105 139
119 3300025904 Ga0207647_10031808 Ga0207647_100318082 139
120 3300025919 Ga0207657_10174730 Ga0207657_101747302 139
121 3300025932 Ga0207690_10035472 Ga0207690_100354724 139
122 3300025986 Ga0207658_10255004 Ga0207658_102550041 139
123 3300046511 Ga0495608_0480630 Ga0495608_0480630_285_719 139
124 3300050490 nmdc:mga03n38_78410_c1 nmdc:mga03n38_78410_c1_922_1341 139
125 3300050492 nmdc:mga0yw44_292243_c1 nmdc:mga0yw44_292243_c1_535_954 139
126 3300050494 nmdc:mga06z11_68784_c1 nmdc:mga06z11_68784_c1_922_1341 139
127 3300003322 rootL2_10328831 rootL2_103288311 140
128 3300005327 Ga0070658_11408403 Ga0070658_114084031 140
129 3300005329 Ga0070683_100230113 Ga0070683_1002301132 140
130 3300005339 Ga0070660_100674527 Ga0070660_1006745272 140
131 3300005367 Ga0070667_100679000 Ga0070667_1006790001 140
132 3300005457 Ga0070662_100584753 Ga0070662_1005847532 140
133 3300005614 Ga0068856_101589617 Ga0068856_1015896172 140
134 3300006038 Ga0075365_10198670 Ga0075365_101986702 140
135 3300006038 Ga0075365_10264089 Ga0075365_102640891 140
136 3300010375 Ga0105239_12455220 Ga0105239_124552202 140
137 3300011119 Ga0105246_10163845 Ga0105246_101638451 140
138 3300013105 Ga0157369_10497891 Ga0157369_104978911 140
139 3300025919 Ga0207657_10341275 Ga0207657_103412752 140
140 3300025944 Ga0207661_10194238 Ga0207661_101942383 140
141 3300025945 Ga0207679_10388299 Ga0207679_103882992 140
142 3300025961 Ga0207712_10285025 Ga0207712_102850252 140
143 3300031731 Ga0307405_10759216 Ga0307405_107592162 140
144 3300031911 Ga0307412_11065272 Ga0307412_110652722 140
145 3300039437 Ga0436365_1753171 Ga0436365_1753171_21_443 140
146 3300041443 Ga0451789_0092772 Ga0451789_0092772_45_467 140
147 3300042439 Ga0439464_0007364 Ga0439464_0007364_550_1011 140
148 3300044658 Ga0466972_0232051 Ga0466972_0232051_98_538 140
149 3300044706 Ga0466964_0035815 Ga0466964_0035815_1067_1507 140
150 3300044901 Ga0466960_0041349 Ga0466960_0041349_1536_1976 140
151 3300047319 Ga0495674_0597849 Ga0495674_0597849_170_604 140
152 3300048913 Ga0496110_0365724 Ga0496110_0365724_249_671 140
153 3300048917 Ga0496114_0084580 Ga0496114_0084580_1725_2147 140
154 3300049583 Ga0501067_0266468 Ga0501067_0266468_101_535 140
155 3300050492 nmdc:mga0yw44_231373_c1 nmdc:mga0yw44_231373_c1_280_705 140

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wkt-assembly1.cif.gz_A cu(i)-bound copper storage protein bscsp3 0.7346 3 121
6wkt-assembly1.cif.gz_A cu(i)-bound copper storage protein bscsp3 0.6988 3 121
5fje-assembly1.cif.gz_A cu(i)-csp1 (copper storage protein 1) from methylosinus trichosporium ob3b 0.6517 5 121
8hf3-assembly1.cif.gz_A cryo-em structure of human zdhhc9/gcp16 complex 0.6459 68 128
5fig-assembly2.cif.gz_F-2 apo-csp3 (copper storage protein 3) from bacillus subtilis 0.6402 1 118
ID Description Score Start End Superfamily
af_Q55E32_2_198_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8115 40 131 1.20.1070.10
af_Q4V4P2_1_144_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7641 1 131 1.20.140.150
af_A8DY57_1_142_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7554 1 131 1.20.140.150
af_Q9XVT7_1_220_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7491 2 136 1.20.140.150
af_C0PV55_1_138_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7466 2 130 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A0Q8WD57-F1-model_v4 DUF2177 domain-containing protein 0.9984 9 135 GO:0016020
AF-A0A5M4FFX1-F1-model_v4 DUF2177 family protein 0.998 3 135 GO:0016020
AF-A0A653NE94-F1-model_v4 DUF2177 domain-containing protein 0.9939 3 136 GO:0016020
AF-A0A2V4N950-F1-model_v4 VanZ-like domain-containing protein 0.982 4 126 GO:0016020
AF-A0A535HRT2-F1-model_v4 DUF2177 family protein 0.9803 2 135 GO:0016020

Feature Viewer

pLDDT pTM Quality
89.08 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map