F221992

General Info

Members Datasets Scaffolds Average Seq Length
155 101 310 315

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100351291|Ga0075431_1003512911
Length 333
Sequence MESVALPRQRLSMRAMSKYRVRPLDLSGLKTIPIAARGGKVRAADFAAPYSKGSGVAGWLDSLPKILAGDSFRFAVEALIRARSAGKPIIWGMGGHVIKCGLATVLTDLMRRGFATAFTMNGSAAIHDFEIAIAGQTSEDVEAVLPDGRFGSAEETGREMNEAIAAAAGDSLGMGEALGARLARIADPAFAPHSLLLQAYNQGIPVTVHVAIGTDTPHTHPAANAAAIGSTTHHDFRLFCSLVAGMNGGGVYLNVGSAVVLPEVFLKAVSAVRNLGAPLAEFTTINLDFLQHYRPKVNVVERPHANAGGRGIALTGHHELMVPLLAAALVECG

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
44 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
57 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
58 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
59 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
60 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
61 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
62 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
63 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
64 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
65 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
66 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
67 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
68 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
72 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
73 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
74 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
75 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
76 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
77 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
78 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
79 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
80 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
81 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
82 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
83 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
86 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
87 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
88 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
89 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
90 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
91 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
92 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
93 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
94 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
95 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
96 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
98 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
99 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
100 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
101 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.65
Rhizosphere 98.06
Stem 0
Stem Tuber 0
Unclassified 10.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100351291 3300006847 Unclassified 1482
2 Ga0070683_100000007 3300005329 Bacteria 342155
3 Ga0070683_100056884 3300005329 Bacteria 3632
4 Ga0068869_100017560 3300005334 Bacteria 4853
5 Ga0070673_100094122 3300005364 Unclassified 2455
6 Ga0070714_100003561 3300005435 Bacteria 11643
7 Ga0070713_100001513 3300005436 Bacteria 14808
8 Ga0070713_100002054 3300005436 Bacteria 13010
9 Ga0070711_100005105 3300005439 Bacteria 7816
10 Ga0070708_100194656 3300005445 Bacteria 1897
11 Ga0070681_10007160 3300005458 Bacteria 10866
12 Ga0070685_10151684 3300005466 Bacteria 1469
13 Ga0070706_100135951 3300005467 Bacteria 2295
14 Ga0070684_100000021 3300005535 Bacteria 132928
15 Ga0070684_100204083 3300005535 Unclassified 1801
16 Ga0070697_100047097 3300005536 Bacteria 3497
17 Ga0070697_100317450 3300005536 Bacteria 1341
18 Ga0068853_100278084 3300005539 Bacteria 1543
19 Ga0068855_100064756 3300005563 Bacteria 4263
20 Ga0068856_100059524 3300005614 Unclassified 3773
21 Ga0068864_100392124 3300005618 Bacteria 1318
22 Ga0068863_100471372 3300005841 Bacteria 1234
23 Ga0068858_100083642 3300005842 Bacteria 2968
24 Ga0070717_10288047 3300006028 Bacteria 1458
25 Ga0070716_100324394 3300006173 Unclassified 1080
26 Ga0068871_100042586 3300006358 Bacteria 3646
27 Ga0068871_100377609 3300006358 Unclassified 1258
28 Ga0075430_100310652 3300006846 Bacteria 1304
29 Ga0075429_100167396 3300006880 Unclassified 1925
30 Ga0075436_100011943 3300006914 Bacteria 5957
31 Ga0075436_100229939 3300006914 Unclassified 1317
32 Ga0075436_100259890 3300006914 Bacteria 1238
33 Ga0105240_10000519 3300009093 Bacteria 70908
34 Ga0105240_10053773 3300009093 Bacteria 5051
35 Ga0105240_10102150 3300009093 Bacteria 3485
36 Ga0105240_10266735 3300009093 Bacteria 1973
37 Ga0105245_10001935 3300009098 Bacteria 18814
38 Ga0114129_10312813 3300009147 Unclassified 2090
39 Ga0105248_10058692 3300009177 Bacteria 4322
40 Ga0105248_10445127 3300009177 Bacteria 1460
41 Ga0105237_10024969 3300009545 Bacteria 6113
42 Ga0105237_10046670 3300009545 Bacteria 4357
43 Ga0105238_10080037 3300009551 Bacteria 3257
44 Ga0105249_10584434 3300009553 Bacteria 1170
45 Ga0105239_10067906 3300010375 Bacteria 3917
46 Ga0157369_10088255 3300013105 Unclassified 3310
47 Ga0157378_10015099 3300013297 Bacteria 6760
48 Ga0157378_10292407 3300013297 Bacteria 1574
49 Ga0157378_10388319 3300013297 Bacteria 1372
50 Ga0163162_10218278 3300013306 Bacteria 2037
51 Ga0157372_10192617 3300013307 Bacteria 2361
52 Ga0157375_10392181 3300013308 Bacteria 1555
53 Ga0163163_10057113 3300014325 Bacteria 3858
54 Ga0163163_10162923 3300014325 Bacteria 2276
55 Ga0157380_10102750 3300014326 Bacteria 2384
56 Ga0157379_10011124 3300014968 Bacteria 7846
57 Ga0157376_10022708 3300014969 Bacteria 4896
58 Ga0157376_10364507 3300014969 Unclassified 1387
59 Ga0213875_10031127 3300021388 Bacteria 2525
60 Ga0207699_10137454 3300025906 Bacteria 1602
61 Ga0207707_10005761 3300025912 Bacteria 10835
62 Ga0207707_10267771 3300025912 Bacteria 1481
63 Ga0207695_10003899 3300025913 Bacteria 20639
64 Ga0207671_10022691 3300025914 Bacteria 4741
65 Ga0207663_10010956 3300025916 Bacteria 4846
66 Ga0207687_10001783 3300025927 Bacteria 14808
67 Ga0207700_10001389 3300025928 Bacteria 13760
68 Ga0207700_10016892 3300025928 Bacteria 4860
69 Ga0207664_10004732 3300025929 Bacteria 9241
70 Ga0207661_10000010 3300025944 Bacteria 375338
71 Ga0207661_10042181 3300025944 Bacteria 3597
72 Ga0207667_10229584 3300025949 Bacteria 1901
73 Ga0207712_10457775 3300025961 Bacteria 1083
74 Ga0207641_10389021 3300026088 Bacteria 1337
75 Ga0265323_10000645 3300028653 Bacteria 19018
76 Ga0265332_10050046 3300031238 Bacteria 1796
77 Ga0265328_10006995 3300031239 Bacteria 4734
78 Ga0265320_10012149 3300031240 Bacteria 5027
79 Ga0265331_10008620 3300031250 Bacteria 5785
80 Ga0265316_10000799 3300031344 Bacteria 34742
81 Ga0265316_10007388 3300031344 Bacteria 10354
82 Ga0265316_10029002 3300031344 Bacteria 4557
83 Ga0265316_10054185 3300031344 Bacteria 3141
84 Ga0265316_10119273 3300031344 Bacteria 1993
85 Ga0265316_10145630 3300031344 Bacteria 1777
86 Ga0265314_10001742 3300031711 Bacteria 23556
87 Ga0373934_0010486 3300035086 Bacteria 3478
88 Ga0373953_0100727 3300035117 Bacteria 1215
89 Ga0373954_0007490 3300035118 Bacteria 4776
90 Ga0373927_0003504 3300035695 Bacteria 11232
91 Ga0373927_0038194 3300035695 Bacteria 3118
92 Ga0373927_0143152 3300035695 Bacteria 1564
93 Ga0373927_0189447 3300035695 Bacteria 1349
94 Ga0373933_0103074 3300035724 Bacteria 1772
95 Ga0373933_0259473 3300035724 Bacteria 1120
96 Ga0373947_0000361 3300035725 Bacteria 25682
97 Ga0373947_0036513 3300035725 Bacteria 2914
98 Ga0373947_0128147 3300035725 Bacteria 1618
99 Ga0373947_0275793 3300035725 Bacteria 1117
100 Ga0373937_0030253 3300036401 Bacteria 4904
101 Ga0373937_0120024 3300036401 Bacteria 2450
102 Ga0373937_0160432 3300036401 Bacteria 2108
103 Ga0373925_0000147 3300037068 Bacteria 75183
104 Ga0373925_0323376 3300037068 Bacteria 1248
105 Ga0373925_0388608 3300037068 Unclassified 1137
106 Ga0436364_0173353 3300037853 Bacteria 5118
107 Ga0453684_0109138 3300044712 Bacteria 3367
108 Ga0451576_0039076 3300045051 Bacteria 5023
109 Ga0451576_0429102 3300045051 Bacteria 1387
110 Ga0451576_0577793 3300045051 Unclassified 1181
111 Ga0495651_0030902 3300046462 Bacteria 4177
112 Ga0495651_0037362 3300046462 Bacteria 3780
113 Ga0495651_0289055 3300046462 Bacteria 1104
114 Ga0495580_0000411 3300046472 Bacteria 35418
115 Ga0495580_0012769 3300046472 Bacteria 6437
116 Ga0495580_0017682 3300046472 Bacteria 5325
117 Ga0495580_0018174 3300046472 Bacteria 5239
118 Ga0495580_0078307 3300046472 Unclassified 2306
119 Ga0495580_0201753 3300046472 Bacteria 1370
120 Ga0495580_0224286 3300046472 Unclassified 1291
121 Ga0495582_0006140 3300046473 Bacteria 6691
122 Ga0495639_0161571 3300046475 Bacteria 1084
123 Ga0495662_0007391 3300046476 Bacteria 5427
124 Ga0495608_0036832 3300046511 Bacteria 3291
125 Ga0495608_0218993 3300046511 Bacteria 1195
126 Ga0495630_0051562 3300046517 Bacteria 3080
127 Ga0495630_0096777 3300046517 Bacteria 2231
128 Ga0495652_0027474 3300046529 Bacteria 5012
129 Ga0495652_0106204 3300046529 Bacteria 2268
130 Ga0495665_0077619 3300046531 Bacteria 1748
131 Ga0495665_0080293 3300046531 Bacteria 1716
132 Ga0495586_0021919 3300046535 Bacteria 3409
133 Ga0495645_0013341 3300046543 Bacteria 5807
134 Ga0495667_0102143 3300046559 Bacteria 1854
135 Ga0495634_0060292 3300046642 Bacteria 2525
136 Ga0495635_0003488 3300046663 Bacteria 10872
137 Ga0495599_0000872 3300046678 Bacteria 16869
138 Ga0495599_0174783 3300046678 Bacteria 1325
139 Ga0495623_0035815 3300046679 Bacteria 3181
140 Ga0495613_0059505 3300046689 Bacteria 2800
141 Ga0495604_0014434 3300047317 Bacteria 6301
142 Ga0495674_0063526 3300047319 Bacteria 3211
143 Ga0495674_0317964 3300047319 Unclassified 1269
144 Ga0495680_0048498 3300047322 Bacteria 3334
145 Ga0495684_0075208 3300047471 Bacteria 2566
146 Ga0495684_0118818 3300047471 Bacteria 1992
147 Ga0496115_0017179 3300048918 Bacteria 5524
148 Ga0501048_0127338 3300049582 Bacteria 1801
149 Ga0501045_0178756 3300049824 Bacteria 1581
150 nmdc:mga0qj67_102823_c1 3300050509 Bacteria 2304
151 nmdc:mga06r32_115450_c1 3300050510 Bacteria 2644
152 nmdc:mga06r32_67099_c1 3300050510 Bacteria 3463
153 nmdc:mga08x19_1024_c1 3300050514 Bacteria 17435
154 nmdc:mga08x19_228092_c1 3300050514 Unclassified 1281
155 Ga0501082_0000190 3300060353 Bacteria 52912
156 Ga0075431_100351291
157 Ga0070683_100000007
158 Ga0070683_100056884
159 Ga0068869_100017560
160 Ga0070673_100094122
161 Ga0070714_100003561
162 Ga0070713_100001513
163 Ga0070713_100002054
164 Ga0070711_100005105
165 Ga0070708_100194656
166 Ga0070681_10007160
167 Ga0070685_10151684
168 Ga0070706_100135951
169 Ga0070684_100000021
170 Ga0070684_100204083
171 Ga0070697_100047097
172 Ga0070697_100317450
173 Ga0068853_100278084
174 Ga0068855_100064756
175 Ga0068856_100059524
176 Ga0068864_100392124
177 Ga0068863_100471372
178 Ga0068858_100083642
179 Ga0070717_10288047
180 Ga0070716_100324394
181 Ga0068871_100042586
182 Ga0068871_100377609
183 Ga0075430_100310652
184 Ga0075429_100167396
185 Ga0075436_100011943
186 Ga0075436_100229939
187 Ga0075436_100259890
188 Ga0105240_10000519
189 Ga0105240_10053773
190 Ga0105240_10102150
191 Ga0105240_10266735
192 Ga0105245_10001935
193 Ga0114129_10312813
194 Ga0105248_10058692
195 Ga0105248_10445127
196 Ga0105237_10024969
197 Ga0105237_10046670
198 Ga0105238_10080037
199 Ga0105249_10584434
200 Ga0105239_10067906
201 Ga0157369_10088255
202 Ga0157378_10015099
203 Ga0157378_10292407
204 Ga0157378_10388319
205 Ga0163162_10218278
206 Ga0157372_10192617
207 Ga0157375_10392181
208 Ga0163163_10057113
209 Ga0163163_10162923
210 Ga0157380_10102750
211 Ga0157379_10011124
212 Ga0157376_10022708
213 Ga0157376_10364507
214 Ga0213875_10031127
215 Ga0207699_10137454
216 Ga0207707_10005761
217 Ga0207707_10267771
218 Ga0207695_10003899
219 Ga0207671_10022691
220 Ga0207663_10010956
221 Ga0207687_10001783
222 Ga0207700_10001389
223 Ga0207700_10016892
224 Ga0207664_10004732
225 Ga0207661_10000010
226 Ga0207661_10042181
227 Ga0207667_10229584
228 Ga0207712_10457775
229 Ga0207641_10389021
230 Ga0265323_10000645
231 Ga0265332_10050046
232 Ga0265328_10006995
233 Ga0265320_10012149
234 Ga0265331_10008620
235 Ga0265316_10000799
236 Ga0265316_10007388
237 Ga0265316_10029002
238 Ga0265316_10054185
239 Ga0265316_10119273
240 Ga0265316_10145630
241 Ga0265314_10001742
242 Ga0373934_0010486
243 Ga0373953_0100727
244 Ga0373954_0007490
245 Ga0373927_0003504
246 Ga0373927_0038194
247 Ga0373927_0143152
248 Ga0373927_0189447
249 Ga0373933_0103074
250 Ga0373933_0259473
251 Ga0373947_0000361
252 Ga0373947_0036513
253 Ga0373947_0128147
254 Ga0373947_0275793
255 Ga0373937_0030253
256 Ga0373937_0120024
257 Ga0373937_0160432
258 Ga0373925_0000147
259 Ga0373925_0323376
260 Ga0373925_0388608
261 Ga0436364_0173353
262 Ga0453684_0109138
263 Ga0451576_0039076
264 Ga0451576_0429102
265 Ga0451576_0577793
266 Ga0495651_0030902
267 Ga0495651_0037362
268 Ga0495651_0289055
269 Ga0495580_0000411
270 Ga0495580_0012769
271 Ga0495580_0017682
272 Ga0495580_0018174
273 Ga0495580_0078307
274 Ga0495580_0201753
275 Ga0495580_0224286
276 Ga0495582_0006140
277 Ga0495639_0161571
278 Ga0495662_0007391
279 Ga0495608_0036832
280 Ga0495608_0218993
281 Ga0495630_0051562
282 Ga0495630_0096777
283 Ga0495652_0027474
284 Ga0495652_0106204
285 Ga0495665_0077619
286 Ga0495665_0080293
287 Ga0495586_0021919
288 Ga0495645_0013341
289 Ga0495667_0102143
290 Ga0495634_0060292
291 Ga0495635_0003488
292 Ga0495599_0000872
293 Ga0495599_0174783
294 Ga0495623_0035815
295 Ga0495613_0059505
296 Ga0495604_0014434
297 Ga0495674_0063526
298 Ga0495674_0317964
299 Ga0495680_0048498
300 Ga0495684_0075208
301 Ga0495684_0118818
302 Ga0496115_0017179
303 Ga0501048_0127338
304 Ga0501045_0178756
305 nmdc:mga0qj67_102823_c1
306 nmdc:mga06r32_115450_c1
307 nmdc:mga06r32_67099_c1
308 nmdc:mga08x19_1024_c1
309 nmdc:mga08x19_228092_c1
310 Ga0501082_0000190

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6juy-assembly1.cif.gz_C crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.7673 57 312
6juy-assembly1.cif.gz_D crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.7392 51 309
6juy-assembly1.cif.gz_A crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.7354 57 312
6lrg-assembly1.cif.gz_B-2 crystal structure of the ternary complex of agre with ornithine and nad+ 0.7246 57 310
6juy-assembly1.cif.gz_B crystal structure of argz, apo structure, an arginine dihydrolase from the ornithine-ammonia cycle in cyanobacteria 0.7235 57 312
ID Description Score Start End Superfamily
4p63B00 Alpha Beta;3-Layer(aba) Sandwich;Deoxyhypusine Synthase;Deoxyhypusine synthase 0.6371 26 309 3.40.910.10
3zgoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.6353 57 311 3.40.50.1220
af_Q07471_200_363_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.6351 55 109 3.40.50.1220
3c2qB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;putative lor/sdh protein like domains 0.6285 57 312 3.40.50.10690
1szcA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.6274 55 311 3.40.50.1220
ID Description Score Start End GO Terms
AF-A0A661SPJ5-F1-model_v4 Deoxyhypusine synthase 0.9462 12 257
AF-A0A1V4RNV3-F1-model_v4 Uncharacterized protein 0.9422 78 272
AF-A0A1F9NDW6-F1-model_v4 Orotidine 5'-phosphate decarboxylase domain-containing protein 0.9339 6 219
AF-A0A1F9DUS2-F1-model_v4 Uncharacterized protein 0.9333 47 312
AF-A0A7W1E911-F1-model_v4 Uncharacterized protein 0.9333 41 310

Map