F221518

General Info

Members Datasets Scaffolds Average Seq Length
155 129 155 205

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100103420|Ga0070659_1001034202
Length 235
Sequence MRMSRDRTGTENFVFARHMCVSAGQGPGMELVPTFAAALIPPVCAACGRACRPEAIVCTRCARRLADADPLFGNGPAGLDRAWSSAPYEGVARNLVGALKFRRLLPVADLMAERIEWLAPAHMLSGTIVPVPPAPPRLRRRGFDPAGELAAALGARLEAPLALCLERRGGGRQVGRRRAERIGHPPRIHACGPVPRSALLVDDVLTTGATLTACARALRAAGSSRVVAVTFARRL

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
35 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
36 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
37 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
65 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
66 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
67 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
68 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
69 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
70 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
71 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
72 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
73 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
74 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
75 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
82 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
83 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
84 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
85 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
86 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
87 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
88 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
89 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
90 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
91 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
94 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
95 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
96 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
97 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
98 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
99 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
100 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
101 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
102 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
105 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
106 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
107 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
122 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
126 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
127 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
128 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
129 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.61
Rhizosphere 87.74
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10013473 3300003373 Bacteria 2102
2 Ga0068868_100000151 3300005338 Bacteria 44963
3 Ga0070691_10000012 3300005341 Bacteria 56648
4 Ga0070668_100017256 3300005347 Bacteria 5404
5 Ga0070673_100011981 3300005364 Bacteria 5939
6 Ga0070688_100000300 3300005365 Bacteria 25290
7 Ga0070659_100103420 3300005366 Bacteria 2294
8 Ga0070667_100000695 3300005367 Bacteria 32405
9 Ga0070700_100085698 3300005441 Bacteria 2044
10 Ga0070685_10000320 3300005466 Bacteria 29816
11 Ga0070684_100417605 3300005535 Bacteria 1238
12 Ga0070672_100000091 3300005543 Bacteria 44187
13 Ga0070665_100155081 3300005548 Bacteria 2292
14 Ga0070665_100574975 3300005548 Bacteria 1140
15 Ga0070704_100371694 3300005549 Bacteria 1212
16 Ga0070664_100184720 3300005564 Bacteria 1855
17 Ga0068856_100026831 3300005614 Bacteria 5617
18 Ga0068864_100000045 3300005618 Bacteria 154739
19 Ga0068866_10000597 3300005718 Bacteria 16444
20 Ga0068851_10000259 3300005834 Bacteria 25118
21 Ga0068851_10003973 3300005834 Bacteria 6624
22 Ga0068858_100261117 3300005842 Bacteria 1646
23 Ga0068860_100015490 3300005843 Bacteria 7445
24 Ga0068860_100156721 3300005843 Bacteria 2195
25 Ga0068860_100337748 3300005843 Bacteria 1481
26 Ga0068862_100008832 3300005844 Bacteria 8345
27 Ga0081538_10000011 3300005981 Bacteria 154554
28 Ga0081540_1000006 3300005983 Bacteria 208724
29 Ga0081539_10003705 3300005985 Bacteria 18213
30 Ga0070712_100001071 3300006175 Bacteria 16531
31 Ga0075430_100017460 3300006846 Bacteria 6112
32 Ga0075433_10000339 3300006852 Bacteria 29053
33 Ga0105245_10006117 3300009098 Bacteria 10584
34 Ga0105249_10026979 3300009553 Bacteria 5180
35 Ga0157338_1002068 3300012515 Bacteria 1534
36 Ga0157378_10106054 3300013297 Bacteria 2570
37 Ga0163162_10748754 3300013306 Bacteria 1096
38 Ga0157379_10053599 3300014968 Bacteria 3603
39 Ga0157376_10135483 3300014969 Bacteria 2203
40 Ga0163161_10013730 3300017792 Bacteria 5641
41 Ga0207656_10002114 3300025321 Bacteria 6635
42 Ga0207656_10008126 3300025321 Bacteria 3851
43 Ga0207642_10159066 3300025899 Unclassified 1211
44 Ga0207695_10680528 3300025913 Bacteria 909
45 Ga0207693_10002622 3300025915 Bacteria 15629
46 Ga0207700_10000025 3300025928 Bacteria 147429
47 Ga0207664_10074561 3300025929 Bacteria 2742
48 Ga0207690_10001648 3300025932 Bacteria 13799
49 Ga0207686_10080656 3300025934 Bacteria 2122
50 Ga0207709_10059785 3300025935 Bacteria 2373
51 Ga0207669_10000004 3300025937 Bacteria 196828
52 Ga0207704_10000146 3300025938 Bacteria 37894
53 Ga0207704_10420210 3300025938 Bacteria 1060
54 Ga0207691_10000190 3300025940 Bacteria 58438
55 Ga0207661_10000492 3300025944 Bacteria 25390
56 Ga0207661_10011186 3300025944 Bacteria 6491
57 Ga0207679_10096272 3300025945 Bacteria 2303
58 Ga0207651_10005233 3300025960 Bacteria 6632
59 Ga0207712_10018816 3300025961 Bacteria 4503
60 Ga0207668_10002301 3300025972 Bacteria 11150
61 Ga0207668_10139496 3300025972 Bacteria 1862
62 Ga0207658_10002223 3300025986 Bacteria 14411
63 Ga0207658_10374607 3300025986 Bacteria 1245
64 Ga0207677_10000372 3300026023 Bacteria 31162
65 Ga0207677_10000919 3300026023 Bacteria 16454
66 Ga0207703_10340176 3300026035 Bacteria 1379
67 Ga0207708_10175875 3300026075 Bacteria 1697
68 Ga0207702_10000607 3300026078 Bacteria 39638
69 Ga0207648_10004376 3300026089 Bacteria 14522
70 Ga0207676_10000016 3300026095 Bacteria 311561
71 Ga0268266_10002949 3300028379 Bacteria 17563
72 Ga0268266_10126061 3300028379 Bacteria 2285
73 Ga0268266_10243909 3300028379 Bacteria 1659
74 Ga0268265_10000555 3300028380 Bacteria 38092
75 Ga0268264_10035012 3300028381 Bacteria 4134
76 Ga0265326_10000007 3300028558 Bacteria 223057
77 Ga0265319_1000025 3300028563 Bacteria 142639
78 Ga0265322_10000001 3300028654 Bacteria 543854
79 Ga0265336_10009760 3300028666 Bacteria 3308
80 Ga0265338_10000486 3300028800 Bacteria 70900
81 Ga0265324_10000309 3300029957 Bacteria 35875
82 Ga0265332_10014576 3300031238 Bacteria 3478
83 Ga0265328_10001155 3300031239 Bacteria 12164
84 Ga0265320_10000002 3300031240 Bacteria 542875
85 Ga0265325_10010625 3300031241 Bacteria 5321
86 Ga0265329_10015065 3300031242 Bacteria 2711
87 Ga0265331_10000774 3300031250 Bacteria 26605
88 Ga0265327_10000011 3300031251 Bacteria 543807
89 Ga0265314_10000058 3300031711 Bacteria 167476
90 Ga0307416_101150280 3300032002 Bacteria 881
91 Ga0373957_0143480 3300035120 Bacteria 977
92 Ga0373937_0033726 3300036401 Bacteria 4652
93 Ga0466965_0151003 3300044683 Bacteria 1214
94 Ga0466957_0415326 3300044842 Bacteria 922
95 Ga0466967_0000027 3300045976 Bacteria 64265
96 Ga0466967_0029185 3300045976 Bacteria 4614
97 Ga0495592_0333855 3300046454 Bacteria 976
98 Ga0495629_0015421 3300046459 Bacteria 5488
99 Ga0495629_0051523 3300046459 Bacteria 2881
100 Ga0495629_0095680 3300046459 Bacteria 2072
101 Ga0495629_0605663 3300046459 Bacteria 732
102 Ga0495641_0040031 3300046461 Bacteria 2182
103 Ga0495582_0000029 3300046473 Bacteria 77919
104 Ga0495639_0016083 3300046475 Bacteria 3245
105 Ga0495662_0082985 3300046476 Bacteria 1560
106 Ga0495608_0000031 3300046511 Bacteria 145255
107 Ga0495618_0179264 3300046514 Bacteria 1347
108 Ga0495628_0000924 3300046516 Bacteria 26910
109 Ga0495652_0000019 3300046529 Bacteria 190248
110 Ga0495652_0224509 3300046529 Bacteria 1409
111 Ga0495645_0006825 3300046543 Bacteria 7931
112 Ga0495634_0002056 3300046642 Bacteria 17049
113 Ga0495625_0000122 3300046660 Bacteria 121146
114 Ga0495625_0354386 3300046660 Unclassified 927
115 Ga0495635_0000016 3300046663 Bacteria 214088
116 Ga0495657_0000024 3300046675 Bacteria 145255
117 Ga0495647_0000025 3300046681 Bacteria 65184
118 Ga0495658_0000026 3300046683 Bacteria 77681
119 Ga0495613_0000073 3300046689 Bacteria 98688
120 Ga0495600_0231298 3300046809 Bacteria 1180
121 Ga0495674_0000731 3300047319 Bacteria 31001
122 Ga0495676_0008108 3300047321 Bacteria 9638
123 Ga0495675_0000428 3300047444 Bacteria 28143
124 Ga0495602_0001790 3300048088 Bacteria 21477
125 Ga0496100_0000018 3300048903 Bacteria 162451
126 Ga0496101_0000221 3300048904 Bacteria 42499
127 Ga0496102_0000146 3300048905 Bacteria 96361
128 Ga0496103_0000008 3300048906 Bacteria 340474
129 Ga0496104_0000004 3300048907 Bacteria 641830
130 Ga0496104_0010400 3300048907 Bacteria 8310
131 Ga0496105_0000001 3300048908 Bacteria 1328178
132 Ga0496105_0012255 3300048908 Bacteria 6788
133 Ga0496106_0000018 3300048909 Bacteria 175028
134 Ga0496107_0000006 3300048910 Bacteria 258746
135 Ga0496108_0003860 3300048911 Bacteria 12036
136 Ga0496109_0217125 3300048912 Bacteria 1798
137 Ga0496109_0334794 3300048912 Bacteria 1429
138 Ga0496112_0000003 3300048915 Bacteria 660147
139 Ga0496113_0034992 3300048916 Bacteria 3670
140 Ga0496114_0000014 3300048917 Bacteria 297902
141 Ga0496115_0000003 3300048918 Bacteria 354994
142 Ga0496115_0000989 3300048918 Bacteria 20585
143 Ga0496120_0109613 3300048923 Bacteria 1444
144 Ga0501042_0443116 3300049578 Unclassified 942
145 Ga0501070_0174717 3300049586 Bacteria 1769
146 Ga0501076_0566174 3300049592 Bacteria 937
147 Ga0501081_0709249 3300049743 Bacteria 755
148 nmdc:mga0qj67_60234_c1 3300050509 Bacteria 3012
149 Ga0495601_0000039 3300053077 Bacteria 79594
150 Ga0495601_0070627 3300053077 Bacteria 2229
151 Ga0495601_0177889 3300053077 Bacteria 1391
152 Ga0495595_0000014 3300053084 Bacteria 145255
153 Ga0495595_0218767 3300053084 Bacteria 950
154 Ga0495619_0000147 3300053085 Bacteria 51947
155 Ga0495619_0003046 3300053085 Bacteria 10884

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0000004 Ga0496104_0000004_83328_83951 176
2 3300048908 Ga0496105_0000001 Ga0496105_0000001_557880_558503 176
3 3300048923 Ga0496120_0109613 Ga0496120_0109613_451_1074 176
4 3300046476 Ga0495662_0082985 Ga0495662_0082985_160_786 177
5 3300005543 Ga0070672_100000091 Ga0070672_10000009117 179
6 3300025940 Ga0207691_10000190 Ga0207691_1000019063 179
7 3300044683 Ga0466965_0151003 Ga0466965_0151003_576_1199 180
8 3300005338 Ga0068868_100000151 Ga0068868_10000015142 181
9 3300026023 Ga0207677_10000372 Ga0207677_1000037220 181
10 3300045976 Ga0466967_0029185 Ga0466967_0029185_1873_2490 181
11 3300005834 Ga0068851_10003973 Ga0068851_100039734 182
12 3300025321 Ga0207656_10002114 Ga0207656_100021143 182
13 3300025972 Ga0207668_10139496 Ga0207668_101394963 183
14 3300032002 Ga0307416_101150280 Ga0307416_1011502802 184
15 3300005364 Ga0070673_100011981 Ga0070673_1000119812 185
16 3300005834 Ga0068851_10000259 Ga0068851_1000025928 185
17 3300025321 Ga0207656_10008126 Ga0207656_100081263 185
18 3300025960 Ga0207651_10005233 Ga0207651_100052337 185
19 3300046459 Ga0495629_0095680 Ga0495629_0095680_651_1280 185
20 3300005441 Ga0070700_100085698 Ga0070700_1000856982 186
21 3300005618 Ga0068864_100000045 Ga0068864_10000004536 186
22 3300005843 Ga0068860_100015490 Ga0068860_1000154907 186
23 3300014969 Ga0157376_10135483 Ga0157376_101354832 186
24 3300026095 Ga0207676_10000016 Ga0207676_10000016127 186
25 3300046514 Ga0495618_0179264 Ga0495618_0179264_663_1289 186
26 3300046642 Ga0495634_0002056 Ga0495634_0002056_4745_5374 186
27 3300046660 Ga0495625_0000122 Ga0495625_0000122_15540_16163 186
28 3300005347 Ga0070668_100017256 Ga0070668_1000172564 187
29 3300005367 Ga0070667_100000695 Ga0070667_10000069523 187
30 3300005548 Ga0070665_100155081 Ga0070665_1001550813 187
31 3300005842 Ga0068858_100261117 Ga0068858_1002611172 187
32 3300005843 Ga0068860_100156721 Ga0068860_1001567213 187
33 3300005843 Ga0068860_100337748 Ga0068860_1003377482 187
34 3300005844 Ga0068862_100008832 Ga0068862_1000088322 187
35 3300009553 Ga0105249_10026979 Ga0105249_100269793 187
36 3300013306 Ga0163162_10748754 Ga0163162_107487542 187
37 3300014968 Ga0157379_10053599 Ga0157379_100535993 187
38 3300025961 Ga0207712_10018816 Ga0207712_100188165 187
39 3300025972 Ga0207668_10002301 Ga0207668_100023013 187
40 3300025986 Ga0207658_10002223 Ga0207658_100022235 187
41 3300026035 Ga0207703_10340176 Ga0207703_103401762 187
42 3300028379 Ga0268266_10126061 Ga0268266_101260613 187
43 3300028380 Ga0268265_10000555 Ga0268265_1000055511 187
44 3300028381 Ga0268264_10035012 Ga0268264_100350122 187
45 3300048912 Ga0496109_0334794 Ga0496109_0334794_583_1206 187
46 3300048907 Ga0496104_0010400 Ga0496104_0010400_4110_4733 188
47 3300048908 Ga0496105_0012255 Ga0496105_0012255_5599_6222 188
48 3300026089 Ga0207648_10004376 Ga0207648_100043762 192
49 3300036401 Ga0373937_0033726 Ga0373937_0033726_2619_3239 192
50 3300046473 Ga0495582_0000029 Ga0495582_0000029_35433_36053 192
51 3300046683 Ga0495658_0000026 Ga0495658_0000026_41890_42510 192
52 3300053077 Ga0495601_0177889 Ga0495601_0177889_435_1058 192
53 3300053084 Ga0495595_0218767 Ga0495595_0218767_144_764 192
54 3300053085 Ga0495619_0003046 Ga0495619_0003046_1824_2444 192
55 3300005341 Ga0070691_10000012 Ga0070691_100000129 193
56 3300005365 Ga0070688_100000300 Ga0070688_1000003009 193
57 3300005366 Ga0070659_100103420 Ga0070659_1001034202 193
58 3300005466 Ga0070685_10000320 Ga0070685_100003209 193
59 3300005535 Ga0070684_100417605 Ga0070684_1004176052 193
60 3300005548 Ga0070665_100574975 Ga0070665_1005749751 193
61 3300005549 Ga0070704_100371694 Ga0070704_1003716942 193
62 3300005564 Ga0070664_100184720 Ga0070664_1001847203 193
63 3300005614 Ga0068856_100026831 Ga0068856_1000268313 193
64 3300005718 Ga0068866_10000597 Ga0068866_100005973 193
65 3300005983 Ga0081540_1000006 Ga0081540_1000006197 193
66 3300005985 Ga0081539_10003705 Ga0081539_100037053 193
67 3300006175 Ga0070712_100001071 Ga0070712_1000010714 193
68 3300006846 Ga0075430_100017460 Ga0075430_1000174604 193
69 3300006852 Ga0075433_10000339 Ga0075433_1000033916 193
70 3300009098 Ga0105245_10006117 Ga0105245_100061173 193
71 3300012515 Ga0157338_1002068 Ga0157338_10020682 193
72 3300013297 Ga0157378_10106054 Ga0157378_101060543 193
73 3300017792 Ga0163161_10013730 Ga0163161_100137305 193
74 3300025899 Ga0207642_10159066 Ga0207642_101590662 193
75 3300025913 Ga0207695_10680528 Ga0207695_106805281 193
76 3300025915 Ga0207693_10002622 Ga0207693_1000262213 193
77 3300025928 Ga0207700_10000025 Ga0207700_1000002571 193
78 3300025929 Ga0207664_10074561 Ga0207664_100745612 193
79 3300025932 Ga0207690_10001648 Ga0207690_100016481 193
80 3300025934 Ga0207686_10080656 Ga0207686_100806562 193
81 3300025935 Ga0207709_10059785 Ga0207709_100597851 193
82 3300025937 Ga0207669_10000004 Ga0207669_1000000497 193
83 3300025938 Ga0207704_10000146 Ga0207704_1000014641 193
84 3300025938 Ga0207704_10420210 Ga0207704_104202102 193
85 3300025944 Ga0207661_10000492 Ga0207661_100004929 193
86 3300025944 Ga0207661_10011186 Ga0207661_100111864 193
87 3300025945 Ga0207679_10096272 Ga0207679_100962723 193
88 3300025986 Ga0207658_10374607 Ga0207658_103746071 193
89 3300026023 Ga0207677_10000919 Ga0207677_1000091917 193
90 3300026075 Ga0207708_10175875 Ga0207708_101758752 193
91 3300026078 Ga0207702_10000607 Ga0207702_100006079 193
92 3300028379 Ga0268266_10002949 Ga0268266_100029496 193
93 3300028379 Ga0268266_10243909 Ga0268266_102439092 193
94 3300028558 Ga0265326_10000007 Ga0265326_1000000780 193
95 3300028563 Ga0265319_1000025 Ga0265319_100002593 193
96 3300028654 Ga0265322_10000001 Ga0265322_10000001225 193
97 3300028666 Ga0265336_10009760 Ga0265336_100097603 193
98 3300028800 Ga0265338_10000486 Ga0265338_1000048660 193
99 3300029957 Ga0265324_10000309 Ga0265324_1000030933 193
100 3300031238 Ga0265332_10014576 Ga0265332_100145762 193
101 3300031239 Ga0265328_10001155 Ga0265328_100011555 193
102 3300031240 Ga0265320_10000002 Ga0265320_10000002224 193
103 3300031241 Ga0265325_10010625 Ga0265325_100106253 193
104 3300031242 Ga0265329_10015065 Ga0265329_100150653 193
105 3300031250 Ga0265331_10000774 Ga0265331_100007743 193
106 3300031251 Ga0265327_10000011 Ga0265327_10000011224 193
107 3300031711 Ga0265314_10000058 Ga0265314_10000058131 193
108 3300035120 Ga0373957_0143480 Ga0373957_0143480_74_700 193
109 3300044842 Ga0466957_0415326 Ga0466957_0415326_216_839 193
110 3300045976 Ga0466967_0000027 Ga0466967_0000027_30100_30723 193
111 3300046454 Ga0495592_0333855 Ga0495592_0333855_143_790 193
112 3300046459 Ga0495629_0015421 Ga0495629_0015421_3661_4284 193
113 3300046459 Ga0495629_0051523 Ga0495629_0051523_1152_1778 193
114 3300046459 Ga0495629_0605663 Ga0495629_0605663_76_702 193
115 3300046461 Ga0495641_0040031 Ga0495641_0040031_48_674 193
116 3300046475 Ga0495639_0016083 Ga0495639_0016083_1760_2383 193
117 3300046511 Ga0495608_0000031 Ga0495608_0000031_132450_133073 193
118 3300046516 Ga0495628_0000924 Ga0495628_0000924_24243_24866 193
119 3300046529 Ga0495652_0000019 Ga0495652_0000019_112743_113366 193
120 3300046529 Ga0495652_0224509 Ga0495652_0224509_424_1050 193
121 3300046543 Ga0495645_0006825 Ga0495645_0006825_4805_5431 193
122 3300046660 Ga0495625_0354386 Ga0495625_0354386_283_906 193
123 3300046663 Ga0495635_0000016 Ga0495635_0000016_53987_54610 193
124 3300046675 Ga0495657_0000024 Ga0495657_0000024_132450_133073 193
125 3300046681 Ga0495647_0000025 Ga0495647_0000025_42998_43621 193
126 3300046689 Ga0495613_0000073 Ga0495613_0000073_15992_16615 193
127 3300046809 Ga0495600_0231298 Ga0495600_0231298_395_1018 193
128 3300047319 Ga0495674_0000731 Ga0495674_0000731_11180_11803 193
129 3300047321 Ga0495676_0008108 Ga0495676_0008108_4336_4959 193
130 3300047444 Ga0495675_0000428 Ga0495675_0000428_12183_12806 193
131 3300048088 Ga0495602_0001790 Ga0495602_0001790_10711_11334 193
132 3300048903 Ga0496100_0000018 Ga0496100_0000018_23143_23766 193
133 3300048904 Ga0496101_0000221 Ga0496101_0000221_32804_33427 193
134 3300048905 Ga0496102_0000146 Ga0496102_0000146_9241_9864 193
135 3300048906 Ga0496103_0000008 Ga0496103_0000008_328760_329383 193
136 3300048909 Ga0496106_0000018 Ga0496106_0000018_165336_165959 193
137 3300048910 Ga0496107_0000006 Ga0496107_0000006_92066_92689 193
138 3300048911 Ga0496108_0003860 Ga0496108_0003860_2495_3118 193
139 3300048912 Ga0496109_0217125 Ga0496109_0217125_1057_1680 193
140 3300048915 Ga0496112_0000003 Ga0496112_0000003_135736_136359 193
141 3300048916 Ga0496113_0034992 Ga0496113_0034992_1370_1993 193
142 3300048917 Ga0496114_0000014 Ga0496114_0000014_144185_144808 193
143 3300048918 Ga0496115_0000003 Ga0496115_0000003_294320_294943 193
144 3300048918 Ga0496115_0000989 Ga0496115_0000989_2537_3160 193
145 3300049578 Ga0501042_0443116 Ga0501042_0443116_276_899 193
146 3300049586 Ga0501070_0174717 Ga0501070_0174717_16_639 193
147 3300049592 Ga0501076_0566174 Ga0501076_0566174_302_925 193
148 3300049743 Ga0501081_0709249 Ga0501081_0709249_90_713 193
149 3300050509 nmdc:mga0qj67_60234_c1 nmdc:mga0qj67_60234_c1_447_1070 193
150 3300053077 Ga0495601_0000039 Ga0495601_0000039_5246_5869 193
151 3300053077 Ga0495601_0070627 Ga0495601_0070627_1457_2080 193
152 3300053084 Ga0495595_0000014 Ga0495595_0000014_12183_12806 193
153 3300053085 Ga0495619_0000147 Ga0495619_0000147_12183_12806 193
154 3300003373 JGI25407J50210_10013473 JGI25407J50210_100134731 204
155 3300005981 Ga0081538_10000011 Ga0081538_100000113 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

138

235

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dku-assembly1.cif.gz_A crystal structures of bacillus subtilis phosphoribosylpyrophosphate synthetase: molecular basis of allosteric inhibition and activation. 0.8169 92 203
1dkr-assembly1.cif.gz_B crystal structures of bacillus subtilis phosphoribosylpyrophosphate synthetase: molecular basis of allosteric inhibition and activation. 0.7824 91 200
6asv-assembly1.cif.gz_A e. coli prpp synthetase 0.7791 91 200
1tq8-assembly2.cif.gz_E-2 crystal structure of protein rv1636 from mycobacterium tuberculosis h37rv 0.7771 165 199
4m0u-assembly1.cif.gz_B crystal structure of human prs1 q133p mutant 0.7691 91 200
ID Description Score Start End Superfamily
af_A4HTJ9_703_814_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.823 159 203 3.40.50.2020
af_P46846_104_226_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8228 84 201 3.40.50.2020
1dkuA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8169 92 203 3.40.50.2020
af_Q2G0S2_154_297_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7954 92 199 3.40.50.2020
af_P46846_104_226_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7862 84 201 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A2M7FDT4-F1-model_v4 Phosphoribosyltransferase domain-containing protein 0.8884 92 204
AF-A0A4P5V7Y0-F1-model_v4 Phosphoribosyltransferase domain-containing protein 0.8862 40 202
AF-A0A537VPY6-F1-model_v4 ComF family protein 0.8859 40 204
AF-A0A6J5ZUS9-F1-model_v4 Unannotated protein 0.8847 40 202
AF-A0A3M2DZZ1-F1-model_v4 ComF family protein 0.8842 40 202

Feature Viewer

pLDDT pTM Quality
79.79 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map