F221480

General Info

Members Datasets Scaffolds Average Seq Length
155 105 310 127

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_101079641|Ga0070669_1010796411
Length 153
Sequence MLIPKGWRPLPRTRSGSGMGITNIDAKVSRPDKTGATVPVTLMVDSGAIYSVLPAAVWRPLDLVGDREVDFSLADGTIITREVSECRFDIEGRGATSPVVLGRDDEGPMLGAVTLETLGLVLNPLTRQLMPIRLMLGSITQRRTTTPPIAPIG

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
60 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
61 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
62 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
63 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
64 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
65 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
66 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
67 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
68 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
71 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
72 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
73 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
74 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
75 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
76 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
77 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
84 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
85 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
86 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
87 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
88 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
89 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
90 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
91 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
92 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
93 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
94 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
95 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
96 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
97 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
98 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
99 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
100 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
101 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
102 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
103 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
104 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
105 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.35
Stem 0
Stem Tuber 0
Unclassified 41.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_101079641 3300005353 Unclassified 691
2 JGI25406J46586_10003938 3300003203 Bacteria 6941
3 JGI25405J52794_10055401 3300003911 Unclassified 854
4 Ga0070683_100000044 3300005329 Bacteria 102122
5 Ga0070668_100965361 3300005347 Bacteria 764
6 Ga0070668_101089116 3300005347 Unclassified 721
7 Ga0070669_100494419 3300005353 Bacteria 1014
8 Ga0070669_100607833 3300005353 Unclassified 916
9 Ga0070669_101234544 3300005353 Bacteria 646
10 Ga0070671_100131815 3300005355 Unclassified 2105
11 Ga0070673_101024295 3300005364 Bacteria 769
12 Ga0070673_101071550 3300005364 Unclassified 752
13 Ga0070667_100120900 3300005367 Bacteria 2278
14 Ga0070694_100149755 3300005444 Bacteria 1703
15 Ga0070708_101044890 3300005445 Unclassified 765
16 Ga0070662_101291491 3300005457 Bacteria 628
17 Ga0068867_100214506 3300005459 Unclassified 1548
18 Ga0070706_100646838 3300005467 Unclassified 982
19 Ga0070699_100009140 3300005518 Bacteria 8594
20 Ga0070699_100065242 3300005518 Bacteria 3159
21 Ga0070699_100075663 3300005518 Bacteria 2930
22 Ga0070699_100491572 3300005518 Bacteria 1114
23 Ga0070699_100703027 3300005518 Bacteria 924
24 Ga0070684_100000032 3300005535 Bacteria 104605
25 Ga0070697_100040579 3300005536 Bacteria 3767
26 Ga0070697_100184415 3300005536 Unclassified 1769
27 Ga0070697_100206009 3300005536 Bacteria 1673
28 Ga0070697_101446267 3300005536 Bacteria 614
29 Ga0070672_101084814 3300005543 Bacteria 711
30 Ga0070672_102100184 3300005543 Unclassified 509
31 Ga0070695_101280037 3300005545 Bacteria 605
32 Ga0070696_100128768 3300005546 Bacteria 1840
33 Ga0070665_100219922 3300005548 Bacteria 1900
34 Ga0068864_101467086 3300005618 Unclassified 685
35 Ga0068861_101016507 3300005719 Unclassified 792
36 Ga0068858_100259074 3300005842 Bacteria 1653
37 Ga0068862_100195453 3300005844 Bacteria 1822
38 Ga0081455_10000681 3300005937 Bacteria 44113
39 Ga0081539_10000005 3300005985 Bacteria 549026
40 Ga0070715_10086103 3300006163 Unclassified 1436
41 Ga0070716_100583556 3300006173 Unclassified 838
42 Ga0075428_101229833 3300006844 Unclassified 789
43 Ga0075431_100117028 3300006847 Bacteria 2750
44 Ga0075433_10111581 3300006852 Bacteria 2426
45 Ga0075433_10155793 3300006852 Bacteria 2032
46 Ga0075434_100245875 3300006871 Bacteria 1808
47 Ga0075434_100278630 3300006871 Unclassified 1692
48 Ga0068865_101110096 3300006881 Unclassified 697
49 Ga0075436_100015235 3300006914 Bacteria 5266
50 Ga0075435_101047400 3300007076 Unclassified 713
51 Ga0099794_10221305 3300007265 Unclassified 972
52 Ga0099794_10271252 3300007265 Bacteria 876
53 Ga0111539_10157636 3300009094 Bacteria 2656
54 Ga0114129_10001520 3300009147 Bacteria 31392
55 Ga0114129_10038596 3300009147 Bacteria 6736
56 Ga0114129_10130012 3300009147 Bacteria 3460
57 Ga0114129_10221856 3300009147 Bacteria 2549
58 Ga0114129_10266943 3300009147 Unclassified 2291
59 Ga0114129_10643762 3300009147 Bacteria 1369
60 Ga0114129_11021987 3300009147 Unclassified 1040
61 Ga0099796_10326455 3300010159 Unclassified 656
62 Ga0157374_10000019 3300013296 Bacteria 280543
63 Ga0157377_10000008 3300014745 Bacteria 394748
64 Ga0157377_10000144 3300014745 Bacteria 45022
65 Ga0157376_11054232 3300014969 Unclassified 837
66 Ga0207684_10001056 3300025910 Bacteria 30828
67 Ga0207646_10000338 3300025922 Bacteria 63455
68 Ga0207681_10560405 3300025923 Unclassified 941
69 Ga0207681_11535664 3300025923 Unclassified 558
70 Ga0207694_10000001 3300025924 Bacteria 4078485
71 Ga0207644_10907078 3300025931 Unclassified 739
72 Ga0207706_10295161 3300025933 Bacteria 1413
73 Ga0207691_11688428 3300025940 Unclassified 513
74 Ga0207661_10000004 3300025944 Bacteria 606391
75 Ga0207651_10270389 3300025960 Bacteria 1400
76 Ga0207658_10370667 3300025986 Unclassified 1252
77 Ga0207648_10241367 3300026089 Bacteria 1609
78 Ga0207675_101571952 3300026118 Unclassified 678
79 Ga0209588_1125890 3300027671 Unclassified 818
80 Ga0209588_1135170 3300027671 Bacteria 785
81 Ga0207428_10425452 3300027907 Unclassified 970
82 Ga0268266_10489559 3300028379 Bacteria 1173
83 Ga0268266_10703446 3300028379 Bacteria 974
84 Ga0268265_10057824 3300028380 Bacteria 2958
85 Ga0307416_100478403 3300032002 Bacteria 1305
86 Ga0373926_0305549 3300035083 Unclassified 621
87 Ga0373936_0071930 3300035113 Bacteria 1427
88 Ga0373941_0006976 3300035115 Bacteria 2745
89 Ga0373946_0657975 3300035171 Unclassified 546
90 Ga0373924_0195961 3300035410 Unclassified 890
91 Ga0373935_0101782 3300035692 Unclassified 1895
92 Ga0373927_0005418 3300035695 Bacteria 8806
93 Ga0373927_0060149 3300035695 Bacteria 2457
94 Ga0373933_0152273 3300035724 Unclassified 1465
95 Ga0373947_0032722 3300035725 Bacteria 3066
96 Ga0373947_0032900 3300035725 Bacteria 3058
97 Ga0373937_0077887 3300036401 Unclassified 3063
98 Ga0373925_0047642 3300037068 Bacteria 3191
99 Ga0373925_0462090 3300037068 Unclassified 1040
100 Ga0436362_0431894 3300039453 Unclassified 623
101 Ga0451839_1499451 3300041496 Unclassified 600
102 Ga0453683_0747410 3300044673 Bacteria 642
103 Ga0453683_0873382 3300044673 Unclassified 594
104 Ga0495603_0243557 3300046455 Unclassified 1036
105 Ga0495580_0658055 3300046472 Unclassified 688
106 Ga0495639_0022387 3300046475 Bacteria 2772
107 Ga0501039_0226950 3300049575 Bacteria 1468
108 Ga0501039_0764525 3300049575 Unclassified 754
109 Ga0501040_0060962 3300049576 Bacteria 2594
110 Ga0501041_0076393 3300049577 Unclassified 2061
111 Ga0501041_0640931 3300049577 Unclassified 679
112 Ga0501046_0041206 3300049580 Bacteria 3685
113 Ga0501046_0061927 3300049580 Bacteria 2924
114 Ga0501046_0587500 3300049580 Unclassified 791
115 Ga0501046_1162886 3300049580 Unclassified 531
116 Ga0501047_0000059 3300049581 Bacteria 138083
117 Ga0501048_0495426 3300049582 Unclassified 876
118 Ga0501071_0936112 3300049587 Unclassified 669
119 Ga0501072_0641783 3300049588 Bacteria 836
120 Ga0501074_0344843 3300049590 Bacteria 1057
121 Ga0501074_0663827 3300049590 Unclassified 736
122 Ga0501075_0135456 3300049591 Bacteria 1876
123 Ga0501076_0078503 3300049592 Bacteria 2649
124 Ga0501076_0687995 3300049592 Bacteria 844
125 Ga0501076_0874777 3300049592 Unclassified 741
126 Ga0501077_0071977 3300049593 Bacteria 2191
127 Ga0501079_0049409 3300049741 Bacteria 3246
128 Ga0501079_0443224 3300049741 Unclassified 1019
129 Ga0501079_0518671 3300049741 Unclassified 937
130 Ga0501080_1340780 3300049742 Unclassified 612
131 Ga0501081_0037479 3300049743 Bacteria 3308
132 Ga0501083_0646731 3300049744 Bacteria 688
133 Ga0501045_0433088 3300049824 Unclassified 978
134 nmdc:mga05p37_19024_c1 3300050507 Bacteria 8305
135 nmdc:mga05p37_203679_c1 3300050507 Bacteria 2395
136 nmdc:mga05p37_213595_c1 3300050507 Bacteria 2331
137 nmdc:mga05p37_366855_c1 3300050507 Bacteria 1691
138 nmdc:mga05p37_80381_c1 3300050507 Bacteria 4016
139 nmdc:mga05p37_879589_c1 3300050507 Unclassified 969
140 nmdc:mga09592_58423_c1 3300050508 Bacteria 3261
141 nmdc:mga0qj67_864197_c1 3300050509 Bacteria 714
142 nmdc:mga06r32_19765_c1 3300050510 Bacteria 6189
143 nmdc:mga08y16_262167_c1 3300050511 Unclassified 1785
144 nmdc:mga0n895_1065542_c1 3300050512 Bacteria 787
145 nmdc:mga0n895_108747_c1 3300050512 Unclassified 2787
146 nmdc:mga0n895_266998_c1 3300050512 Bacteria 1736
147 nmdc:mga0n895_7365_c1 3300050512 Bacteria 9436
148 nmdc:mga0rr50_1538177_c1 3300050513 Unclassified 562
149 nmdc:mga08x19_512930_c1 3300050514 Bacteria 847
150 nmdc:mga0a205_1177081_c1 3300050515 Unclassified 614
151 Ga0495612_0354561 3300053078 Unclassified 663
152 Ga0501084_0424954 3300054114 Bacteria 1123
153 Ga0501084_1843278 3300054114 Unclassified 505
154 Ga0530510_0162332 3300061734 Unclassified 1653
155 Ga0530510_0789236 3300061734 Bacteria 724
156 Ga0070669_101079641
157 JGI25406J46586_10003938
158 JGI25405J52794_10055401
159 Ga0070683_100000044
160 Ga0070668_100965361
161 Ga0070668_101089116
162 Ga0070669_100494419
163 Ga0070669_100607833
164 Ga0070669_101234544
165 Ga0070671_100131815
166 Ga0070673_101024295
167 Ga0070673_101071550
168 Ga0070667_100120900
169 Ga0070694_100149755
170 Ga0070708_101044890
171 Ga0070662_101291491
172 Ga0068867_100214506
173 Ga0070706_100646838
174 Ga0070699_100009140
175 Ga0070699_100065242
176 Ga0070699_100075663
177 Ga0070699_100491572
178 Ga0070699_100703027
179 Ga0070684_100000032
180 Ga0070697_100040579
181 Ga0070697_100184415
182 Ga0070697_100206009
183 Ga0070697_101446267
184 Ga0070672_101084814
185 Ga0070672_102100184
186 Ga0070695_101280037
187 Ga0070696_100128768
188 Ga0070665_100219922
189 Ga0068864_101467086
190 Ga0068861_101016507
191 Ga0068858_100259074
192 Ga0068862_100195453
193 Ga0081455_10000681
194 Ga0081539_10000005
195 Ga0070715_10086103
196 Ga0070716_100583556
197 Ga0075428_101229833
198 Ga0075431_100117028
199 Ga0075433_10111581
200 Ga0075433_10155793
201 Ga0075434_100245875
202 Ga0075434_100278630
203 Ga0068865_101110096
204 Ga0075436_100015235
205 Ga0075435_101047400
206 Ga0099794_10221305
207 Ga0099794_10271252
208 Ga0111539_10157636
209 Ga0114129_10001520
210 Ga0114129_10038596
211 Ga0114129_10130012
212 Ga0114129_10221856
213 Ga0114129_10266943
214 Ga0114129_10643762
215 Ga0114129_11021987
216 Ga0099796_10326455
217 Ga0157374_10000019
218 Ga0157377_10000008
219 Ga0157377_10000144
220 Ga0157376_11054232
221 Ga0207684_10001056
222 Ga0207646_10000338
223 Ga0207681_10560405
224 Ga0207681_11535664
225 Ga0207694_10000001
226 Ga0207644_10907078
227 Ga0207706_10295161
228 Ga0207691_11688428
229 Ga0207661_10000004
230 Ga0207651_10270389
231 Ga0207658_10370667
232 Ga0207648_10241367
233 Ga0207675_101571952
234 Ga0209588_1125890
235 Ga0209588_1135170
236 Ga0207428_10425452
237 Ga0268266_10489559
238 Ga0268266_10703446
239 Ga0268265_10057824
240 Ga0307416_100478403
241 Ga0373926_0305549
242 Ga0373936_0071930
243 Ga0373941_0006976
244 Ga0373946_0657975
245 Ga0373924_0195961
246 Ga0373935_0101782
247 Ga0373927_0005418
248 Ga0373927_0060149
249 Ga0373933_0152273
250 Ga0373947_0032722
251 Ga0373947_0032900
252 Ga0373937_0077887
253 Ga0373925_0047642
254 Ga0373925_0462090
255 Ga0436362_0431894
256 Ga0451839_1499451
257 Ga0453683_0747410
258 Ga0453683_0873382
259 Ga0495603_0243557
260 Ga0495580_0658055
261 Ga0495639_0022387
262 Ga0501039_0226950
263 Ga0501039_0764525
264 Ga0501040_0060962
265 Ga0501041_0076393
266 Ga0501041_0640931
267 Ga0501046_0041206
268 Ga0501046_0061927
269 Ga0501046_0587500
270 Ga0501046_1162886
271 Ga0501047_0000059
272 Ga0501048_0495426
273 Ga0501071_0936112
274 Ga0501072_0641783
275 Ga0501074_0344843
276 Ga0501074_0663827
277 Ga0501075_0135456
278 Ga0501076_0078503
279 Ga0501076_0687995
280 Ga0501076_0874777
281 Ga0501077_0071977
282 Ga0501079_0049409
283 Ga0501079_0443224
284 Ga0501079_0518671
285 Ga0501080_1340780
286 Ga0501081_0037479
287 Ga0501083_0646731
288 Ga0501045_0433088
289 nmdc:mga05p37_19024_c1
290 nmdc:mga05p37_203679_c1
291 nmdc:mga05p37_213595_c1
292 nmdc:mga05p37_366855_c1
293 nmdc:mga05p37_80381_c1
294 nmdc:mga05p37_879589_c1
295 nmdc:mga09592_58423_c1
296 nmdc:mga0qj67_864197_c1
297 nmdc:mga06r32_19765_c1
298 nmdc:mga08y16_262167_c1
299 nmdc:mga0n895_1065542_c1
300 nmdc:mga0n895_108747_c1
301 nmdc:mga0n895_266998_c1
302 nmdc:mga0n895_7365_c1
303 nmdc:mga0rr50_1538177_c1
304 nmdc:mga08x19_512930_c1
305 nmdc:mga0a205_1177081_c1
306 Ga0495612_0354561
307 Ga0501084_0424954
308 Ga0501084_1843278
309 Ga0530510_0162332
310 Ga0530510_0789236

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2j9j-assembly1.cif.gz_B atomic-resolution crystal structure of chemically-synthesized hiv-1 protease complexed with inhibitor jg-365 0.8124 5 105
3uhl-assembly2.cif.gz_C crystal structure of multidrug resistant hiv-1 protease clinical isolate pr20 in complex with p2-nc substrate analog 0.8047 5 105
6oot-assembly1.cif.gz_B hiv-1 protease nl4-3 l89v, l90m mutant in complex with darunavir 0.7831 7 105
2fgv-assembly1.cif.gz_B x-ray crystal structure of hiv-1 protease t80n variant in complex with the inhibitor saquinavir used to explore the role of invariant thr80 in hiv-1 protease structure, function, and viral infectivity. 0.7807 7 105
4ejk-assembly1.cif.gz_A hiv protease (pr) dimer in closed form with pepstatin in active site and fragment 1f1-n in the outside/top of flap 0.7761 7 105
ID Description Score Start End Superfamily
af_Q54VD1_290_401_2.40.70.10 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.8258 26 114 2.40.70.10
af_O16635_354_450_2.40.70.10 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.8061 1 98 2.40.70.10
af_O16635_354_450_2.40.70.10 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.7691 1 98 2.40.70.10
af_Q54J95_15_120_2.40.70.10 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.7601 5 105 2.40.70.10
2b7fC00 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.7565 5 98 2.40.70.10
ID Description Score Start End GO Terms
AF-A0A2M7GYJ0-F1-model_v4 Peptidase A2 domain-containing protein 0.9876 3 99
AF-A0A535ABF5-F1-model_v4 Aspartyl protease 0.9836 9 118 GO:0006508
GO:0008233
AF-A0A1F6B537-F1-model_v4 Aspartyl protease 0.9791 1 118
AF-A0A534QEF0-F1-model_v4 Peptidase A2 domain-containing protein 0.9775 1 89 GO:0004190
GO:0006508
AF-A0A0S8J288-F1-model_v4 Aspartyl protease 0.9758 1 113

Map