F219990

General Info

Members Datasets Scaffolds Average Seq Length
154 98 308 184

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10134029|Ga0265316_101340291
Length 210
Sequence MSGIKPMPIGSPVFRRAVAPGIDIRLLEPGDAEAVFAAADRDRAYLREWLPWVDRTHSVEDVRRFIEEVVSPQWVGNRGPQCGIWMDGSLAGSIGCHPIDWANRSCSLGYWIESGRQGQGIVTRCVCEMLNYLFDTQRLHRVVIQCAVGNHRSCAIPERLGFTQEGVLRQAQLIGRRWLDLSTWSILEDEWRRVAQARGRRTEAPPSRTP

Samples

Sample ID Description Type Environment
1 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
12 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
19 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
20 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
21 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
22 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
38 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
54 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
55 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
56 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
57 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
58 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
60 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
61 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
62 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
63 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
64 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
65 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
66 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
67 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
68 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
69 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
70 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
71 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
72 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
73 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
74 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
75 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
76 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
77 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
78 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
79 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
80 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
81 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
82 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
83 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
84 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
85 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
86 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
87 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
88 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
89 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
90 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
91 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
92 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
93 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
95 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
96 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
97 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
98 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 0.65
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 95.45
Stem 0
Stem Tuber 0
Unclassified 25.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265316_10134029 3300031344 Bacteria 1864
2 rootH1_10007052 3300003323 Unclassified 1354
3 Ga0070676_10694590 3300005328 Bacteria 742
4 Ga0070670_100800941 3300005331 Unclassified 851
5 Ga0068869_100897580 3300005334 Unclassified 767
6 Ga0070680_100066857 3300005336 Bacteria 2948
7 Ga0068868_100127401 3300005338 Bacteria 2081
8 Ga0070689_100203155 3300005340 Bacteria 1619
9 Ga0070713_100114959 3300005436 Unclassified 2351
10 Ga0070713_100397564 3300005436 Bacteria 1286
11 Ga0070679_100178076 3300005530 Bacteria 2099
12 Ga0070672_100800168 3300005543 Unclassified 829
13 Ga0070686_101166777 3300005544 Unclassified 638
14 Ga0068859_100526129 3300005617 Bacteria 1277
15 Ga0068859_100906770 3300005617 Bacteria 966
16 Ga0068863_100054653 3300005841 Bacteria 3782
17 Ga0068863_100207511 3300005841 Bacteria 1886
18 Ga0068863_101451677 3300005841 Unclassified 694
19 Ga0068858_100652279 3300005842 Bacteria 1023
20 Ga0070717_11469168 3300006028 Unclassified 619
21 Ga0097621_100245096 3300006237 Unclassified 1568
22 Ga0097621_101224896 3300006237 Unclassified 707
23 Ga0068871_100125971 3300006358 Bacteria 2168
24 Ga0068871_100427871 3300006358 Bacteria 1183
25 Ga0075434_100183668 3300006871 Bacteria 2112
26 Ga0068865_100567666 3300006881 Unclassified 955
27 Ga0075436_100220409 3300006914 Unclassified 1346
28 Ga0097620_100526134 3300006931 Bacteria 1277
29 Ga0097620_100906773 3300006931 Bacteria 966
30 Ga0105240_10208962 3300009093 Bacteria 2282
31 Ga0114129_10201822 3300009147 Bacteria 2693
32 Ga0105248_10046717 3300009177 Bacteria 4854
33 Ga0105248_10268312 3300009177 Bacteria 1922
34 Ga0105248_10278266 3300009177 Bacteria 1884
35 Ga0105248_10571679 3300009177 Bacteria 1275
36 Ga0105248_10847216 3300009177 Unclassified 1032
37 Ga0105248_11247433 3300009177 Bacteria 841
38 Ga0105237_10433677 3300009545 Bacteria 1320
39 Ga0105237_10989347 3300009545 Unclassified 848
40 Ga0105238_10075310 3300009551 Bacteria 3367
41 Ga0105238_10114192 3300009551 Unclassified 2680
42 Ga0105246_10158219 3300011119 Bacteria 1723
43 Ga0157370_10937874 3300013104 Unclassified 785
44 Ga0157369_10104072 3300013105 Bacteria 3024
45 Ga0157374_10374674 3300013296 Bacteria 1417
46 Ga0157374_11005328 3300013296 Unclassified 853
47 Ga0157378_10597213 3300013297 Bacteria 1115
48 Ga0157378_10871122 3300013297 Bacteria 930
49 Ga0163162_10637609 3300013306 Unclassified 1190
50 Ga0163162_10667057 3300013306 Bacteria 1163
51 Ga0157375_10244966 3300013308 Bacteria 1952
52 Ga0163163_10083418 3300014325 Bacteria 3201
53 Ga0163163_10407174 3300014325 Bacteria 1419
54 Ga0157376_10399682 3300014969 Bacteria 1328
55 Ga0157376_11183104 3300014969 Bacteria 792
56 Ga0213873_10002672 3300021358 Bacteria 3112
57 Ga0213874_10000055 3300021377 Bacteria 16175
58 Ga0213874_10000343 3300021377 Bacteria 9206
59 Ga0207695_10146992 3300025913 Bacteria 2300
60 Ga0207660_10083142 3300025917 Bacteria 2357
61 Ga0207650_10818916 3300025925 Unclassified 789
62 Ga0207700_10054074 3300025928 Bacteria 3012
63 Ga0207700_10210050 3300025928 Unclassified 1645
64 Ga0207686_10268542 3300025934 Bacteria 1254
65 Ga0207711_10058048 3300025941 Bacteria 3328
66 Ga0207711_10757024 3300025941 Unclassified 905
67 Ga0207661_12138753 3300025944 Unclassified 506
68 Ga0207679_10280929 3300025945 Bacteria 1428
69 Ga0207712_10888226 3300025961 Unclassified 787
70 Ga0207677_10395255 3300026023 Unclassified 1171
71 Ga0207703_10723227 3300026035 Unclassified 947
72 Ga0207641_10190408 3300026088 Bacteria 1885
73 Ga0268264_10713029 3300028381 Bacteria 997
74 Ga0265760_10050168 3300031090 Bacteria 1255
75 Ga0265331_10028621 3300031250 Bacteria 2785
76 Ga0265331_10108323 3300031250 Bacteria 1275
77 Ga0265316_10001558 3300031344 Bacteria 24564
78 Ga0265316_10029186 3300031344 Bacteria 4539
79 Ga0265316_10041484 3300031344 Bacteria 3683
80 Ga0265316_10105224 3300031344 Bacteria 2141
81 Ga0265316_10156462 3300031344 Bacteria 1705
82 Ga0265316_10192450 3300031344 Bacteria 1514
83 Ga0265316_10257700 3300031344 Bacteria 1279
84 Ga0265316_10422982 3300031344 Bacteria 958
85 Ga0265342_10045400 3300031712 Bacteria 2645
86 Ga0373952_0092629 3300035092 Unclassified 787
87 Ga0373927_0178482 3300035695 Bacteria 1393
88 Ga0373927_0313756 3300035695 Unclassified 1032
89 Ga0373927_0627406 3300035695 Unclassified 710
90 Ga0373927_0811825 3300035695 Bacteria 618
91 Ga0373947_0380014 3300035725 Bacteria 951
92 Ga0373947_0746094 3300035725 Unclassified 668
93 Ga0373947_0795433 3300035725 Unclassified 646
94 Ga0373937_0760836 3300036401 Unclassified 916
95 Ga0373937_0901628 3300036401 Bacteria 833
96 Ga0373937_0913122 3300036401 Unclassified 827
97 Ga0373925_0145526 3300037068 Bacteria 1858
98 Ga0373925_0691843 3300037068 Unclassified 841
99 Ga0436365_0277483 3300039437 Bacteria 881
100 Ga0436365_0289524 3300039437 Bacteria 1058
101 Ga0436363_0677960 3300039450 Bacteria 16173
102 Ga0436363_1552967 3300039450 Bacteria 17125
103 Ga0436362_0134985 3300039453 Bacteria 3512
104 Ga0466961_0014762 3300044693 Bacteria 5018
105 Ga0466970_0031155 3300044765 Bacteria 2816
106 Ga0451576_0075522 3300045051 Bacteria 3507
107 Ga0451576_0293449 3300045051 Bacteria 1700
108 Ga0466958_0001694 3300045836 Bacteria 10628
109 Ga0466967_0072609 3300045976 Unclassified 3085
110 Ga0495592_0410565 3300046454 Unclassified 856
111 Ga0495651_0124204 3300046462 Bacteria 1892
112 Ga0495651_0345642 3300046462 Unclassified 984
113 Ga0495580_0000042 3300046472 Bacteria 70551
114 Ga0495580_0022613 3300046472 Bacteria 4625
115 Ga0495580_0285989 3300046472 Bacteria 1124
116 Ga0495639_0064048 3300046475 Bacteria 1689
117 Ga0495662_0270323 3300046476 Unclassified 837
118 Ga0495664_0079418 3300046477 Bacteria 1966
119 Ga0495664_0291610 3300046477 Bacteria 985
120 Ga0495594_0054295 3300046499 Bacteria 2208
121 Ga0495594_0498030 3300046499 Bacteria 692
122 Ga0495630_0141095 3300046517 Bacteria 1832
123 Ga0495666_0191352 3300046526 Bacteria 943
124 Ga0495587_0036044 3300046536 Bacteria 2977
125 Ga0495645_0043940 3300046543 Unclassified 3259
126 Ga0495645_0145341 3300046543 Bacteria 1652
127 Ga0495657_0259243 3300046675 Bacteria 1045
128 Ga0495623_0019904 3300046679 Bacteria 4339
129 Ga0495658_0069742 3300046683 Bacteria 2038
130 Ga0495613_0254487 3300046689 Bacteria 1225
131 Ga0495624_0190733 3300046690 Bacteria 1247
132 Ga0495600_0342985 3300046809 Bacteria 937
133 Ga0495600_0506874 3300046809 Unclassified 741
134 Ga0495581_0127607 3300047315 Bacteria 1482
135 Ga0495604_0031961 3300047317 Bacteria 4173
136 Ga0495604_0123700 3300047317 Bacteria 1869
137 Ga0495636_0218322 3300047318 Unclassified 875
138 Ga0495674_0004279 3300047319 Bacteria 13739
139 Ga0495674_0098009 3300047319 Bacteria 2497
140 Ga0495674_0322516 3300047319 Bacteria 1258
141 Ga0495674_0743304 3300047319 Bacteria 767
142 Ga0495675_0112886 3300047444 Bacteria 1695
143 Ga0495684_0001993 3300047471 Bacteria 16410
144 Ga0495602_0053174 3300048088 Bacteria 3589
145 Ga0495602_0171760 3300048088 Bacteria 1682
146 Ga0495602_0196804 3300048088 Bacteria 1541
147 Ga0495614_0151177 3300048089 Bacteria 1036
148 Ga0501037_0018453 3300049573 Bacteria 5143
149 Ga0501037_0364507 3300049573 Bacteria 995
150 Ga0501044_0009321 3300049823 Bacteria 10709
151 nmdc:mga0n895_528923_c1 3300050512 Bacteria 1186
152 Ga0501082_0000138 3300060353 Bacteria 59990
153 Ga0466962_0058958 3300061719 Bacteria 1832
154 2904760651 2904755435 Bacteria 7986759
155 Ga0265316_10134029
156 rootH1_10007052
157 Ga0070676_10694590
158 Ga0070670_100800941
159 Ga0068869_100897580
160 Ga0070680_100066857
161 Ga0068868_100127401
162 Ga0070689_100203155
163 Ga0070713_100114959
164 Ga0070713_100397564
165 Ga0070679_100178076
166 Ga0070672_100800168
167 Ga0070686_101166777
168 Ga0068859_100526129
169 Ga0068859_100906770
170 Ga0068863_100054653
171 Ga0068863_100207511
172 Ga0068863_101451677
173 Ga0068858_100652279
174 Ga0070717_11469168
175 Ga0097621_100245096
176 Ga0097621_101224896
177 Ga0068871_100125971
178 Ga0068871_100427871
179 Ga0075434_100183668
180 Ga0068865_100567666
181 Ga0075436_100220409
182 Ga0097620_100526134
183 Ga0097620_100906773
184 Ga0105240_10208962
185 Ga0114129_10201822
186 Ga0105248_10046717
187 Ga0105248_10268312
188 Ga0105248_10278266
189 Ga0105248_10571679
190 Ga0105248_10847216
191 Ga0105248_11247433
192 Ga0105237_10433677
193 Ga0105237_10989347
194 Ga0105238_10075310
195 Ga0105238_10114192
196 Ga0105246_10158219
197 Ga0157370_10937874
198 Ga0157369_10104072
199 Ga0157374_10374674
200 Ga0157374_11005328
201 Ga0157378_10597213
202 Ga0157378_10871122
203 Ga0163162_10637609
204 Ga0163162_10667057
205 Ga0157375_10244966
206 Ga0163163_10083418
207 Ga0163163_10407174
208 Ga0157376_10399682
209 Ga0157376_11183104
210 Ga0213873_10002672
211 Ga0213874_10000055
212 Ga0213874_10000343
213 Ga0207695_10146992
214 Ga0207660_10083142
215 Ga0207650_10818916
216 Ga0207700_10054074
217 Ga0207700_10210050
218 Ga0207686_10268542
219 Ga0207711_10058048
220 Ga0207711_10757024
221 Ga0207661_12138753
222 Ga0207679_10280929
223 Ga0207712_10888226
224 Ga0207677_10395255
225 Ga0207703_10723227
226 Ga0207641_10190408
227 Ga0268264_10713029
228 Ga0265760_10050168
229 Ga0265331_10028621
230 Ga0265331_10108323
231 Ga0265316_10001558
232 Ga0265316_10029186
233 Ga0265316_10041484
234 Ga0265316_10105224
235 Ga0265316_10156462
236 Ga0265316_10192450
237 Ga0265316_10257700
238 Ga0265316_10422982
239 Ga0265342_10045400
240 Ga0373952_0092629
241 Ga0373927_0178482
242 Ga0373927_0313756
243 Ga0373927_0627406
244 Ga0373927_0811825
245 Ga0373947_0380014
246 Ga0373947_0746094
247 Ga0373947_0795433
248 Ga0373937_0760836
249 Ga0373937_0901628
250 Ga0373937_0913122
251 Ga0373925_0145526
252 Ga0373925_0691843
253 Ga0436365_0277483
254 Ga0436365_0289524
255 Ga0436363_0677960
256 Ga0436363_1552967
257 Ga0436362_0134985
258 Ga0466961_0014762
259 Ga0466970_0031155
260 Ga0451576_0075522
261 Ga0451576_0293449
262 Ga0466958_0001694
263 Ga0466967_0072609
264 Ga0495592_0410565
265 Ga0495651_0124204
266 Ga0495651_0345642
267 Ga0495580_0000042
268 Ga0495580_0022613
269 Ga0495580_0285989
270 Ga0495639_0064048
271 Ga0495662_0270323
272 Ga0495664_0079418
273 Ga0495664_0291610
274 Ga0495594_0054295
275 Ga0495594_0498030
276 Ga0495630_0141095
277 Ga0495666_0191352
278 Ga0495587_0036044
279 Ga0495645_0043940
280 Ga0495645_0145341
281 Ga0495657_0259243
282 Ga0495623_0019904
283 Ga0495658_0069742
284 Ga0495613_0254487
285 Ga0495624_0190733
286 Ga0495600_0342985
287 Ga0495600_0506874
288 Ga0495581_0127607
289 Ga0495604_0031961
290 Ga0495604_0123700
291 Ga0495636_0218322
292 Ga0495674_0004279
293 Ga0495674_0098009
294 Ga0495674_0322516
295 Ga0495674_0743304
296 Ga0495675_0112886
297 Ga0495684_0001993
298 Ga0495602_0053174
299 Ga0495602_0171760
300 Ga0495602_0196804
301 Ga0495614_0151177
302 Ga0501037_0018453
303 Ga0501037_0364507
304 Ga0501044_0009321
305 nmdc:mga0n895_528923_c1
306 Ga0501082_0000138
307 Ga0466962_0058958
308 2904760651

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

22

163

0.9

PF13420

Acetyltransf_4

Acetyltransferase (GNAT) domain

24

184

0.81

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

42

162

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7n-assembly1.cif.gz_B ribosomal l7/l12 alpha-n-protein acetyltransferase in complex with coenzyme a (coa free sulfhydryl) 0.9665 4 179
1nsl-assembly1.cif.gz_D crystal structure of probable acetyltransferase 0.963 6 182
3r96-assembly1.cif.gz_A crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with acetyl-coa and amp 0.9614 8 179
1nsl-assembly1.cif.gz_B crystal structure of probable acetyltransferase 0.9568 6 182
1nsl-assembly1.cif.gz_E crystal structure of probable acetyltransferase 0.9532 6 182
ID Description Score Start End Superfamily
af_Q2G132_3_176_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9933 8 178 3.40.630.30
af_Q2G132_3_176_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9707 8 178 3.40.630.30
1nslB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9533 7 182 3.40.630.30
3r9eB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9508 2 179 3.40.630.30
af_O05578_9_186_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9443 14 181 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2A2RRD6-F1-model_v4 N-acetyltransferase domain-containing protein 0.9943 19 178 GO:0005737
GO:0008999
GO:1990189
AF-A0A3D2A233-F1-model_v4 RimJ/RimL family protein N-acetyltransferase 0.9906 6 181 GO:0005737
GO:0008999
GO:1990189
AF-A0A2T6KAB5-F1-model_v4 Ribosomal-protein-serine acetyltransferase 0.99 3 147 GO:0005737
GO:0008999
GO:1990189
AF-A0A4R7B2D7-F1-model_v4 Ribosomal-protein-serine acetyltransferase 0.9899 6 188 GO:0005737
GO:0008999
GO:1990189
AF-A0A2V1GUZ3-F1-model_v4 N-acetyltransferase domain-containing protein 0.9889 6 187 GO:0005737
GO:0008999
GO:1990189

Map