F219954

General Info

Members Datasets Scaffolds Average Seq Length
154 128 308 220

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10000822|Ga0265338_1000082244
Length 255
Sequence MERQQLGDRPEPLIAHRGALAKWIPSGSSGGTVRGVTEPSYLRDTRVAYDTVAVDYAELLRDELAAKPLDRALLGAFAELVQAAGNAPVADLGCGPGRVTAHLRALGLDAFGVDLSPAMIAVARRTYPDLTFREGSMAALDLADGVLGGVVAWYSVIHTPPDRLPVVFAEFERVLGPGGHLLLAFQAGDARVHLEQAYGHTVSLDAYRLSPETVAELLRASGFVVFAQLVREPDEREKTQQAYVIAVKRVEPELS

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
16 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
17 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
20 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
28 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
32 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
33 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
34 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
35 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
36 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
37 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
49 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
50 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
51 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
52 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
53 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
54 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
55 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
59 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
60 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
62 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
63 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
64 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
65 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
66 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
67 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
68 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
69 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
70 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
71 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
72 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
73 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
74 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
75 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
76 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
77 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
78 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
79 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
80 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
81 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
82 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
83 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
84 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
85 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
86 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
87 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
88 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
89 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
90 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
91 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
92 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
93 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
96 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
99 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
100 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
101 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
102 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
103 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
104 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
105 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
106 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
107 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
108 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
109 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
110 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
111 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
112 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
113 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
114 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
115 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
116 2619618881 Frankia sp. ACN1ag Isolate Unclassified
117 2619619003 Frankia sp. CpI1-P Isolate Nodule
118 2626541554 Frankia sp. AvcI.1 Isolate Nodule
119 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
120 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
121 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
122 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
123 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
124 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
125 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
126 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
127 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
128 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.26
Metatranscriptomes 0
Isolates 9.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.09
Nodule 1.3
Rhizoplane 14.29
Rhizosphere 62.34
Stem 0
Stem Tuber 0.65
Unclassified 5.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10000822 3300028800 Bacteria 52358
2 JGI25164J39214_1000398 3300002772 Bacteria 25206
3 JGI25165J46597_1000125 3300003214 Bacteria 131155
4 Ga0070658_10013672 3300005327 Bacteria 6513
5 Ga0070687_100065292 3300005343 Bacteria 1936
6 Ga0070692_10064517 3300005345 Bacteria 1937
7 Ga0070671_100508687 3300005355 Bacteria 1036
8 Ga0070674_100133406 3300005356 Bacteria 1855
9 Ga0070673_100181576 3300005364 Unclassified 1802
10 Ga0070714_100102187 3300005435 Bacteria 2527
11 Ga0070710_10000774 3300005437 Bacteria 15266
12 Ga0070685_10087897 3300005466 Bacteria 1876
13 Ga0070686_100022266 3300005544 Bacteria 3772
14 Ga0068859_100093137 3300005617 Bacteria 3065
15 Ga0068866_10002359 3300005718 Bacteria 7832
16 Ga0097621_100071370 3300006237 Bacteria 2870
17 Ga0075428_100001070 3300006844 Bacteria 29103
18 Ga0075431_100011714 3300006847 Bacteria 8847
19 Ga0075431_100390878 3300006847 Bacteria 1393
20 Ga0068865_100086743 3300006881 Bacteria 2260
21 Ga0068865_100108178 3300006881 Unclassified 2046
22 Ga0097620_100093133 3300006931 Bacteria 3065
23 Ga0105245_10203140 3300009098 Bacteria 1904
24 Ga0105245_10439780 3300009098 Bacteria 1310
25 Ga0105247_10006574 3300009101 Bacteria 7189
26 Ga0105243_10241581 3300009148 Unclassified 1607
27 Ga0105242_10014084 3300009176 Bacteria 6190
28 Ga0105248_10008658 3300009177 Bacteria 11180
29 Ga0105248_10094204 3300009177 Bacteria 3372
30 Ga0105248_10166361 3300009177 Bacteria 2486
31 Ga0105249_10054672 3300009553 Bacteria 3651
32 Ga0157374_10512766 3300013296 Bacteria 1204
33 Ga0157378_10002408 3300013297 Bacteria 16633
34 Ga0157378_10227920 3300013297 Bacteria 1774
35 Ga0157375_10032025 3300013308 Bacteria 4982
36 Ga0163163_10014581 3300014325 Bacteria 7230
37 Ga0157379_10028100 3300014968 Bacteria 5006
38 Ga0157379_10054670 3300014968 Bacteria 3567
39 Ga0183367_1002 3300015688 Bacteria 1101531
40 Ga0213875_10001545 3300021388 Bacteria 14760
41 Ga0213875_10016262 3300021388 Bacteria 3610
42 Ga0207427_100039 3300025231 Bacteria 291576
43 Ga0209437_100868 3300025233 Bacteria 12607
44 Ga0209233_1000014 3300025261 Bacteria 996641
45 Ga0207642_10005781 3300025899 Bacteria 4065
46 Ga0207710_10000105 3300025900 Bacteria 105872
47 Ga0207705_10049565 3300025909 Bacteria 3022
48 Ga0207681_10247375 3300025923 Bacteria 1391
49 Ga0207664_10384253 3300025929 Bacteria 1247
50 Ga0207686_10191490 3300025934 Bacteria 1458
51 Ga0207709_10177437 3300025935 Unclassified 1501
52 Ga0207711_10270367 3300025941 Bacteria 1564
53 Ga0207668_10975534 3300025972 Bacteria 757
54 Ga0207703_10363050 3300026035 Bacteria 1336
55 Ga0207648_10211610 3300026089 Bacteria 1721
56 Ga0265338_10003797 3300028800 Bacteria 20996
57 Ga0307511_10000753 3300030521 Bacteria 34607
58 Ga0265325_10001465 3300031241 Bacteria 16598
59 Ga0265339_10022085 3300031249 Unclassified 3691
60 Ga0265316_10034168 3300031344 Bacteria 4133
61 Ga0265313_10007620 3300031595 Bacteria 7347
62 Ga0307508_10015362 3300031616 Bacteria 6974
63 Ga0307508_10154492 3300031616 Bacteria 1898
64 Ga0265314_10063267 3300031711 Unclassified 2511
65 Ga0307413_10020730 3300031824 Bacteria 3504
66 Ga0307410_10247742 3300031852 Bacteria 1384
67 Ga0307409_100182310 3300031995 Bacteria 1860
68 Ga0307409_100328477 3300031995 Bacteria 1434
69 Ga0307409_100752583 3300031995 Bacteria 978
70 Ga0307415_100257079 3300032126 Bacteria 1423
71 Ga0307415_100424218 3300032126 Bacteria 1142
72 Ga0307415_100440580 3300032126 Bacteria 1123
73 Ga0307507_10139283 3300033179 Bacteria 1866
74 Ga0373937_0285605 3300036401 Bacteria 1559
75 Ga0395898_0157285 3300037466 Bacteria 2174
76 Ga0436364_0557817 3300037853 Bacteria 17239
77 Ga0439449_0003047 3300042007 Bacteria 6526
78 Ga0466972_0071019 3300044658 Bacteria 1661
79 Ga0466965_0001991 3300044683 Bacteria 8544
80 Ga0466965_0127509 3300044683 Bacteria 1317
81 Ga0466966_0399117 3300044684 Bacteria 826
82 Ga0466968_0069380 3300044735 Bacteria 1532
83 Ga0466967_0683544 3300045976 Bacteria 1016
84 Ga0495638_0072639 3300046460 Bacteria 2102
85 Ga0495585_0021653 3300046492 Bacteria 3691
86 Ga0495594_0103911 3300046499 Bacteria 1599
87 Ga0495631_0151603 3300046518 Bacteria 995
88 Ga0495643_0002681 3300046522 Bacteria 13761
89 Ga0495622_0190404 3300046557 Bacteria 917
90 Ga0495633_0032779 3300046558 Bacteria 2508
91 Ga0495588_0247555 3300046674 Bacteria 940
92 Ga0495613_0001495 3300046689 Bacteria 17786
93 Ga0495670_0084018 3300046691 Bacteria 1624
94 Ga0495589_0091933 3300046794 Bacteria 1473
95 Ga0495660_0074958 3300046810 Bacteria 1786
96 Ga0495674_0699269 3300047319 Unclassified 796
97 Ga0495683_0098899 3300047323 Bacteria 1405
98 Ga0495685_000799 3300047447 Bacteria 9646
99 Ga0495686_0013779 3300047472 Bacteria 5601
100 Ga0495602_0106669 3300048088 Bacteria 2286
101 Ga0496100_0045678 3300048903 Bacteria 2812
102 Ga0496101_0006592 3300048904 Bacteria 7481
103 Ga0496101_0598631 3300048904 Bacteria 872
104 Ga0496102_0058125 3300048905 Bacteria 3533
105 Ga0496104_0005691 3300048907 Bacteria 10907
106 Ga0496104_0011001 3300048907 Bacteria 8094
107 Ga0496105_0004246 3300048908 Bacteria 10775
108 Ga0496105_0011266 3300048908 Bacteria 7058
109 Ga0496105_0044419 3300048908 Bacteria 3665
110 Ga0496106_0046569 3300048909 Bacteria 3261
111 Ga0496106_0462259 3300048909 Unclassified 1019
112 Ga0496107_0055711 3300048910 Bacteria 2855
113 Ga0496108_0013228 3300048911 Bacteria 6725
114 Ga0496109_0002503 3300048912 Bacteria 15410
115 Ga0496109_0084655 3300048912 Bacteria 2926
116 Ga0496110_0001990 3300048913 Bacteria 15195
117 Ga0496110_0033075 3300048913 Bacteria 4471
118 Ga0496111_0001026 3300048914 Bacteria 15333
119 Ga0496112_0015930 3300048915 Bacteria 7026
120 Ga0496113_0025774 3300048916 Bacteria 4196
121 Ga0496114_0059600 3300048917 Bacteria 3189
122 Ga0496114_0061535 3300048917 Bacteria 3140
123 Ga0496119_0000445 3300048922 Bacteria 56425
124 Ga0496120_0001870 3300048923 Bacteria 23432
125 Ga0496126_0003498 3300048929 Bacteria 19815
126 Ga0496126_0191160 3300048929 Bacteria 1734
127 nmdc:mga0qj67_59741_c1 3300050509 Bacteria 3024
128 nmdc:mga06r32_1459_c2 3300050510 Bacteria 7955
129 nmdc:mga06r32_265337_c1 3300050510 Bacteria 1704
130 nmdc:mga0a205_551908_c1 3300050515 Bacteria 1007
131 Ga0500635_0000078 3300053080 Bacteria 63528
132 Ga0500578_0047787 3300053086 Bacteria 2745
133 Ga0500644_0053067 3300053088 Bacteria 1398
134 Ga0500641_0194977 3300053096 Bacteria 866
135 Ga0500654_062497 3300053099 Bacteria 1892
136 Ga0500569_002461 3300053109 Bacteria 3651
137 Ga0500579_060839 3300053143 Bacteria 2243
138 Ga0500616_0017665 3300053153 Bacteria 4044
139 Ga0500634_0002328 3300053161 Bacteria 7964
140 2579852484 2579778521 Bacteria 7624758
141 2619855793 2619618881 Bacteria 7521104
142 2620348044 2619619003 Bacteria 7619552
143 2626635196 2626541554 Bacteria 7741902
144 2676473077 2675903058 Bacteria 6822861
145 2795782883 2795385470 Bacteria 8317180
146 2827633432 2827628540 Bacteria 6858585
147 2884764135 2884763398 Bacteria 4091164
148 2891397032 2891395885 Bacteria 9251614
149 2891403892 2891395885 Bacteria 9251614
150 2891558161 2891554331 Bacteria 8812224
151 2895428158 2895427314 Bacteria 13147766
152 8003872367 8003870546 Bacteria 7396674
153 8047714932 8047710418 Bacteria 11023148
154 8055178217 8055172936 Bacteria 9305943
155 Ga0265338_10000822
156 JGI25164J39214_1000398
157 JGI25165J46597_1000125
158 Ga0070658_10013672
159 Ga0070687_100065292
160 Ga0070692_10064517
161 Ga0070671_100508687
162 Ga0070674_100133406
163 Ga0070673_100181576
164 Ga0070714_100102187
165 Ga0070710_10000774
166 Ga0070685_10087897
167 Ga0070686_100022266
168 Ga0068859_100093137
169 Ga0068866_10002359
170 Ga0097621_100071370
171 Ga0075428_100001070
172 Ga0075431_100011714
173 Ga0075431_100390878
174 Ga0068865_100086743
175 Ga0068865_100108178
176 Ga0097620_100093133
177 Ga0105245_10203140
178 Ga0105245_10439780
179 Ga0105247_10006574
180 Ga0105243_10241581
181 Ga0105242_10014084
182 Ga0105248_10008658
183 Ga0105248_10094204
184 Ga0105248_10166361
185 Ga0105249_10054672
186 Ga0157374_10512766
187 Ga0157378_10002408
188 Ga0157378_10227920
189 Ga0157375_10032025
190 Ga0163163_10014581
191 Ga0157379_10028100
192 Ga0157379_10054670
193 Ga0183367_1002
194 Ga0213875_10001545
195 Ga0213875_10016262
196 Ga0207427_100039
197 Ga0209437_100868
198 Ga0209233_1000014
199 Ga0207642_10005781
200 Ga0207710_10000105
201 Ga0207705_10049565
202 Ga0207681_10247375
203 Ga0207664_10384253
204 Ga0207686_10191490
205 Ga0207709_10177437
206 Ga0207711_10270367
207 Ga0207668_10975534
208 Ga0207703_10363050
209 Ga0207648_10211610
210 Ga0265338_10003797
211 Ga0307511_10000753
212 Ga0265325_10001465
213 Ga0265339_10022085
214 Ga0265316_10034168
215 Ga0265313_10007620
216 Ga0307508_10015362
217 Ga0307508_10154492
218 Ga0265314_10063267
219 Ga0307413_10020730
220 Ga0307410_10247742
221 Ga0307409_100182310
222 Ga0307409_100328477
223 Ga0307409_100752583
224 Ga0307415_100257079
225 Ga0307415_100424218
226 Ga0307415_100440580
227 Ga0307507_10139283
228 Ga0373937_0285605
229 Ga0395898_0157285
230 Ga0436364_0557817
231 Ga0439449_0003047
232 Ga0466972_0071019
233 Ga0466965_0001991
234 Ga0466965_0127509
235 Ga0466966_0399117
236 Ga0466968_0069380
237 Ga0466967_0683544
238 Ga0495638_0072639
239 Ga0495585_0021653
240 Ga0495594_0103911
241 Ga0495631_0151603
242 Ga0495643_0002681
243 Ga0495622_0190404
244 Ga0495633_0032779
245 Ga0495588_0247555
246 Ga0495613_0001495
247 Ga0495670_0084018
248 Ga0495589_0091933
249 Ga0495660_0074958
250 Ga0495674_0699269
251 Ga0495683_0098899
252 Ga0495685_000799
253 Ga0495686_0013779
254 Ga0495602_0106669
255 Ga0496100_0045678
256 Ga0496101_0006592
257 Ga0496101_0598631
258 Ga0496102_0058125
259 Ga0496104_0005691
260 Ga0496104_0011001
261 Ga0496105_0004246
262 Ga0496105_0011266
263 Ga0496105_0044419
264 Ga0496106_0046569
265 Ga0496106_0462259
266 Ga0496107_0055711
267 Ga0496108_0013228
268 Ga0496109_0002503
269 Ga0496109_0084655
270 Ga0496110_0001990
271 Ga0496110_0033075
272 Ga0496111_0001026
273 Ga0496112_0015930
274 Ga0496113_0025774
275 Ga0496114_0059600
276 Ga0496114_0061535
277 Ga0496119_0000445
278 Ga0496120_0001870
279 Ga0496126_0003498
280 Ga0496126_0191160
281 nmdc:mga0qj67_59741_c1
282 nmdc:mga06r32_1459_c2
283 nmdc:mga06r32_265337_c1
284 nmdc:mga0a205_551908_c1
285 Ga0500635_0000078
286 Ga0500578_0047787
287 Ga0500644_0053067
288 Ga0500641_0194977
289 Ga0500654_062497
290 Ga0500569_002461
291 Ga0500579_060839
292 Ga0500616_0017665
293 Ga0500634_0002328
294 2579852484
295 2619855793
296 2620348044
297 2626635196
298 2676473077
299 2795782883
300 2827633432
301 2884764135
302 2891397032
303 2891403892
304 2891558161
305 2895428158
306 8003872367
307 8047714932
308 8055178217

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

89

179

0.97

PF08241

Methyltransf_11

Methyltransferase domain

90

183

0.95

PF08242

Methyltransf_12

Methyltransferase domain

90

181

0.83

PF13847

Methyltransf_31

Methyltransferase domain

83

232

0.83

PF13489

Methyltransf_23

Methyltransferase domain

56

228

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sm3-assembly1.cif.gz_A-2 crystal structure of sam-dependent methyltransferases q8puk2_metma from methanosarcina mazei. northeast structural genomics consortium target mar262. 0.9007 51 212
2p8j-assembly1.cif.gz_B crystal structure of s-adenosylmethionine-dependent methyltransferase (np_349143.1) from clostridium acetobutylicum at 2.00 a resolution 0.8603 51 212
3h2b-assembly1.cif.gz_A crystal structure of the sam-dependent methyltransferase cg3271 from corynebacterium glutamicum in complex with s-adenosyl-l-homocysteine and pyrophosphate. northeast structural genomics consortium target cgr113a 0.8573 4 212
6zxy-assembly1.cif.gz_B structure of archaeoglobus fulgidus trm11 m2g10 trna methyltransferase enzyme 0.8571 51 213
6uak-assembly1.cif.gz_A-2 lahsb - c-terminal methyltransferase involved in ripp biosynthesis 0.8571 53 155
ID Description Score Start End Superfamily
af_A0A1D6NEM6_1_118_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9301 76 148 3.40.50.150
af_A0A1D6QMW6_179_313_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9179 55 155 3.40.50.150
3sm3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9007 51 212 3.40.50.150
af_F4J554_15_194_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8986 51 116 3.40.50.150
af_O13871_19_175_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8935 51 146 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A561SM05-F1-model_v4 Methyltransferase family protein 0.9921 1 212 GO:0008168
GO:0032259
AF-A0A561SM05-F1-model_v4 Methyltransferase family protein 0.9829 1 212 GO:0008168
GO:0032259
AF-A0A1H3UIM5-F1-model_v4 Acetyl esterase/lipase 0.9784 6 213 GO:0016787
AF-A0A6I5CB23-F1-model_v4 Methyltransferase domain-containing protein 0.9782 1 189 GO:0008168
GO:0009058
GO:0032259
AF-A0A6G9YIZ8-F1-model_v4 Methyltransferase domain-containing protein 0.9764 8 213 GO:0008168
GO:0032259

Map