F219843

General Info

Members Datasets Scaffolds Average Seq Length
154 129 308 386

Family's Representative Sequence

Representative Sequence 3300025961|Ga0207712_10069920|Ga0207712_100699202
Length 402
Sequence MASACPSLLKARNRTMKRSTGQTIRVGSGDDVYQAFVPAPLPPAPPLKLTAVDHDLIERANRALGKLDGMTSLLPDTSLFIYAYVRKEALISSQIEGTQSSFSDLLLYESDQSPGVPMEDVREVSDYVAALDHGLKRLRGGFPLSLRLLREIHGVLLRSGRGHHKTPGEFRRSQVWIGGSRPGNARFVPPPTDKVGECMGALEKFLHGDPVETPTLLKAALAHVQFETIHPFLDGNGRLGRLLITFLLCAEGALSEPILYLSLHFKTRRQEYYDHLQRVRTHGDWEGWLRFFLEGVINTSDEAISMTRRILALFEKHRRELEKHGRAAASAFRVHEYLQKKPITGIREIEKDLGLTYPTVAGALDRMKKQRIVKELTGFKRNRVFTYAPYVELLSEGTEPLR

Samples

Sample ID Description Type Environment
1 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
45 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
63 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
64 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
66 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
77 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
82 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
83 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
84 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
85 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
86 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
87 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
88 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
89 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
90 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
91 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
92 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
93 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
94 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
95 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
96 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
97 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
98 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
99 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
100 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
112 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
117 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
118 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
119 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
120 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
121 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
122 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
123 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
124 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
125 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
126 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
127 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
128 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
129 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.51
Metatranscriptomes 0.65
Isolates 5.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.6
Nodule 1.95
Rhizoplane 4.55
Rhizosphere 83.77
Stem 0
Stem Tuber 0
Unclassified 4.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207712_10069920 3300025961 Bacteria 2520
2 Ga0058692_1000021 3300003856 Bacteria 240308
3 Ga0065707_10004121 3300005295 Bacteria 3681
4 Ga0070658_10078432 3300005327 Bacteria 2711
5 Ga0070670_100000400 3300005331 Bacteria 35600
6 Ga0070670_100373397 3300005331 Bacteria 1256
7 Ga0068869_100127610 3300005334 Bacteria 1952
8 Ga0068868_100000010 3300005338 Bacteria 117927
9 Ga0068868_100000570 3300005338 Bacteria 24700
10 Ga0070691_10000006 3300005341 Bacteria 66177
11 Ga0070669_100034612 3300005353 Bacteria 3657
12 Ga0070674_100208540 3300005356 Bacteria 1513
13 Ga0070714_100008669 3300005435 Bacteria 7949
14 Ga0070714_100257066 3300005435 Bacteria 1616
15 Ga0070700_100040812 3300005441 Bacteria 2843
16 Ga0068867_100027778 3300005459 Bacteria 4070
17 Ga0068867_100058323 3300005459 Bacteria 2861
18 Ga0070699_100090779 3300005518 Unclassified 2670
19 Ga0070699_100120433 3300005518 Bacteria 2307
20 Ga0070693_100019928 3300005547 Bacteria 3528
21 Ga0070704_100149636 3300005549 Bacteria 1834
22 Ga0068855_100020129 3300005563 Bacteria 8013
23 Ga0068856_100114543 3300005614 Bacteria 2696
24 Ga0068859_100183535 3300005617 Unclassified 2175
25 Ga0068861_100021154 3300005719 Bacteria 4674
26 Ga0068861_100079544 3300005719 Bacteria 2563
27 Ga0068861_100152939 3300005719 Bacteria 1895
28 Ga0068861_100379540 3300005719 Bacteria 1248
29 Ga0068863_100000032 3300005841 Bacteria 172402
30 Ga0068860_100035422 3300005843 Bacteria 4787
31 Ga0081455_10004179 3300005937 Bacteria 16273
32 Ga0081540_1029742 3300005983 Bacteria 3037
33 Ga0070717_10037776 3300006028 Bacteria 3922
34 Ga0075364_10017832 3300006051 Bacteria 4439
35 Ga0070716_100077492 3300006173 Bacteria 1973
36 Ga0068871_100187465 3300006358 Bacteria 1780
37 Ga0068865_100000001 3300006881 Bacteria 288199
38 Ga0097620_100183531 3300006931 Unclassified 2175
39 Ga0099794_10054281 3300007265 Bacteria 1934
40 Ga0099794_10076422 3300007265 Bacteria 1646
41 Ga0105240_10045599 3300009093 Bacteria 5560
42 Ga0114129_10295410 3300009147 Bacteria 2161
43 Ga0105237_10078937 3300009545 Bacteria 3281
44 Ga0105249_10117893 3300009553 Bacteria 2518
45 Ga0105239_10003546 3300010375 Bacteria 19082
46 Ga0157371_10008095 3300013102 Bacteria 8404
47 Ga0157369_10006660 3300013105 Bacteria 13350
48 Ga0157374_10010507 3300013296 Bacteria 7966
49 Ga0157378_10000595 3300013297 Bacteria 33901
50 Ga0157378_10332309 3300013297 Unclassified 1479
51 Ga0157380_10117452 3300014326 Bacteria 2247
52 Ga0157377_10117962 3300014745 Bacteria 1604
53 Ga0213876_10004039 3300021384 Bacteria 8258
54 Ga0224572_1005464 3300024225 Bacteria 2268
55 Ga0207650_10000105 3300025925 Bacteria 110180
56 Ga0207650_10013109 3300025925 Bacteria 5735
57 Ga0207659_10026837 3300025926 Bacteria 3892
58 Ga0207669_10033854 3300025937 Bacteria 2889
59 Ga0207704_10002328 3300025938 Bacteria 8532
60 Ga0207665_10010614 3300025939 Bacteria 6050
61 Ga0207691_10022427 3300025940 Bacteria 5954
62 Ga0207667_10085619 3300025949 Bacteria 3263
63 Ga0207677_10000057 3300026023 Bacteria 97301
64 Ga0207677_10000504 3300026023 Bacteria 25273
65 Ga0207639_10011264 3300026041 Bacteria 6204
66 Ga0207639_10328287 3300026041 Bacteria 1360
67 Ga0207702_10110876 3300026078 Bacteria 2439
68 Ga0207641_10000071 3300026088 Bacteria 151812
69 Ga0207648_10028605 3300026089 Bacteria 4941
70 Ga0207648_10082714 3300026089 Bacteria 2800
71 Ga0207675_100058176 3300026118 Bacteria 3608
72 Ga0207675_100061447 3300026118 Bacteria 3507
73 Ga0207675_100176782 3300026118 Bacteria 2042
74 Ga0207675_100442410 3300026118 Bacteria 1287
75 Ga0207683_10258320 3300026121 Bacteria 1591
76 Ga0209371_1000045 3300027312 Bacteria 316174
77 Ga0207428_10055345 3300027907 Bacteria 3155
78 Ga0268264_10022142 3300028381 Bacteria 5188
79 Ga0265318_10001059 3300028577 Bacteria 17431
80 Ga0268256_1000047 3300030500 Bacteria 316174
81 Ga0265762_1001488 3300030760 Bacteria 4247
82 Ga0265320_10004688 3300031240 Bacteria 8921
83 Ga0265329_10002630 3300031242 Bacteria 8080
84 Ga0265340_10010020 3300031247 Bacteria 5076
85 Ga0265331_10000081 3300031250 Bacteria 136351
86 Ga0265316_10018742 3300031344 Bacteria 5942
87 Ga0307509_10000051 3300031507 Bacteria 165037
88 Ga0307408_100141976 3300031548 Bacteria 1886
89 Ga0265313_10010342 3300031595 Bacteria 5917
90 Ga0265314_10037171 3300031711 Unclassified 3531
91 Ga0265342_10001528 3300031712 Bacteria 21402
92 Ga0307415_100204701 3300032126 Bacteria 1569
93 Ga0373943_0018006 3300035170 Bacteria 3241
94 Ga0373946_0043899 3300035171 Bacteria 1844
95 Ga0373947_0055884 3300035725 Bacteria 2385
96 Ga0373947_0140211 3300035725 Bacteria 1550
97 Ga0373925_0016228 3300037068 Bacteria 5390
98 Ga0373925_0148077 3300037068 Bacteria 1841
99 Ga0436365_0750692 3300039437 Bacteria 27909
100 Ga0495580_0003923 3300046472 Bacteria 12552
101 Ga0495639_0000964 3300046475 Bacteria 12948
102 Ga0495630_0124003 3300046517 Bacteria 1960
103 Ga0495586_0011994 3300046535 Bacteria 4604
104 Ga0495658_0038810 3300046683 Bacteria 2638
105 Ga0495613_0060547 3300046689 Bacteria 2773
106 Ga0495624_0000013 3300046690 Bacteria 115278
107 Ga0495581_0047560 3300047315 Bacteria 2479
108 Ga0495581_0080712 3300047315 Bacteria 1883
109 Ga0495676_0050450 3300047321 Bacteria 3337
110 Ga0495679_007928 3300047446 Bacteria 4371
111 Ga0495614_0048146 3300048089 Bacteria 1828
112 Ga0496100_0000032 3300048903 Bacteria 99877
113 Ga0496101_0000012 3300048904 Bacteria 268127
114 Ga0496104_0061290 3300048907 Bacteria 3566
115 Ga0496106_0000092 3300048909 Bacteria 70312
116 Ga0496106_0365573 3300048909 Unclassified 1159
117 Ga0496107_0000031 3300048910 Bacteria 100522
118 Ga0496110_0003127 3300048913 Bacteria 12572
119 Ga0496117_0112086 3300048920 Bacteria 1697
120 Ga0496118_0052321 3300048921 Bacteria 3116
121 Ga0496126_0114901 3300048929 Bacteria 2341
122 Ga0501032_0021082 3300049569 Bacteria 4532
123 Ga0501033_0019091 3300049570 Bacteria 5183
124 Ga0501034_0110935 3300049571 Bacteria 2734
125 Ga0501034_0219018 3300049571 Bacteria 1856
126 Ga0501036_0064572 3300049572 Bacteria 3098
127 Ga0501038_0102592 3300049574 Bacteria 2380
128 Ga0501038_0192783 3300049574 Bacteria 1639
129 Ga0501039_0110899 3300049575 Bacteria 2145
130 Ga0501043_0033324 3300049579 Bacteria 4052
131 Ga0501046_0054545 3300049580 Bacteria 3143
132 Ga0501047_0161752 3300049581 Bacteria 2110
133 Ga0501048_0064789 3300049582 Bacteria 2584
134 Ga0501073_0068333 3300049589 Bacteria 2476
135 Ga0501076_0037878 3300049592 Bacteria 3784
136 Ga0501080_0145676 3300049742 Bacteria 2189
137 Ga0501083_0076698 3300049744 Bacteria 2218
138 Ga0501083_0157486 3300049744 Bacteria 1486
139 Ga0501044_0051397 3300049823 Bacteria 4249
140 nmdc:mga05p37_221038_c1 3300050507 Bacteria 2286
141 nmdc:mga08y16_338957_c1 3300050511 Bacteria 1546
142 Ga0500583_0066897 3300053092 Unclassified 1711
143 Ga0500634_0000603 3300053161 Bacteria 12008
144 Ga0500634_0076133 3300053161 Bacteria 1742
145 Ga0501084_0217909 3300054114 Bacteria 1610
146 2687582382 2687453130 Bacteria 4227172
147 2871500968 2871495908 Bacteria 6935695
148 2876385985 2876377896 Bacteria 6565995
149 2881370208 2881364244 Bacteria 7710352
150 2906661878 2906660503 Bacteria 8595048
151 2929195722 2929195423 Bacteria 5325372
152 2938016260 2938014810 Bacteria 6700592
153 8004644331 8004640170 Bacteria 6723001
154 8021625473 8021622325 Bacteria 4844743
155 Ga0207712_10069920
156 Ga0058692_1000021
157 Ga0065707_10004121
158 Ga0070658_10078432
159 Ga0070670_100000400
160 Ga0070670_100373397
161 Ga0068869_100127610
162 Ga0068868_100000010
163 Ga0068868_100000570
164 Ga0070691_10000006
165 Ga0070669_100034612
166 Ga0070674_100208540
167 Ga0070714_100008669
168 Ga0070714_100257066
169 Ga0070700_100040812
170 Ga0068867_100027778
171 Ga0068867_100058323
172 Ga0070699_100090779
173 Ga0070699_100120433
174 Ga0070693_100019928
175 Ga0070704_100149636
176 Ga0068855_100020129
177 Ga0068856_100114543
178 Ga0068859_100183535
179 Ga0068861_100021154
180 Ga0068861_100079544
181 Ga0068861_100152939
182 Ga0068861_100379540
183 Ga0068863_100000032
184 Ga0068860_100035422
185 Ga0081455_10004179
186 Ga0081540_1029742
187 Ga0070717_10037776
188 Ga0075364_10017832
189 Ga0070716_100077492
190 Ga0068871_100187465
191 Ga0068865_100000001
192 Ga0097620_100183531
193 Ga0099794_10054281
194 Ga0099794_10076422
195 Ga0105240_10045599
196 Ga0114129_10295410
197 Ga0105237_10078937
198 Ga0105249_10117893
199 Ga0105239_10003546
200 Ga0157371_10008095
201 Ga0157369_10006660
202 Ga0157374_10010507
203 Ga0157378_10000595
204 Ga0157378_10332309
205 Ga0157380_10117452
206 Ga0157377_10117962
207 Ga0213876_10004039
208 Ga0224572_1005464
209 Ga0207650_10000105
210 Ga0207650_10013109
211 Ga0207659_10026837
212 Ga0207669_10033854
213 Ga0207704_10002328
214 Ga0207665_10010614
215 Ga0207691_10022427
216 Ga0207667_10085619
217 Ga0207677_10000057
218 Ga0207677_10000504
219 Ga0207639_10011264
220 Ga0207639_10328287
221 Ga0207702_10110876
222 Ga0207641_10000071
223 Ga0207648_10028605
224 Ga0207648_10082714
225 Ga0207675_100058176
226 Ga0207675_100061447
227 Ga0207675_100176782
228 Ga0207675_100442410
229 Ga0207683_10258320
230 Ga0209371_1000045
231 Ga0207428_10055345
232 Ga0268264_10022142
233 Ga0265318_10001059
234 Ga0268256_1000047
235 Ga0265762_1001488
236 Ga0265320_10004688
237 Ga0265329_10002630
238 Ga0265340_10010020
239 Ga0265331_10000081
240 Ga0265316_10018742
241 Ga0307509_10000051
242 Ga0307408_100141976
243 Ga0265313_10010342
244 Ga0265314_10037171
245 Ga0265342_10001528
246 Ga0307415_100204701
247 Ga0373943_0018006
248 Ga0373946_0043899
249 Ga0373947_0055884
250 Ga0373947_0140211
251 Ga0373925_0016228
252 Ga0373925_0148077
253 Ga0436365_0750692
254 Ga0495580_0003923
255 Ga0495639_0000964
256 Ga0495630_0124003
257 Ga0495586_0011994
258 Ga0495658_0038810
259 Ga0495613_0060547
260 Ga0495624_0000013
261 Ga0495581_0047560
262 Ga0495581_0080712
263 Ga0495676_0050450
264 Ga0495679_007928
265 Ga0495614_0048146
266 Ga0496100_0000032
267 Ga0496101_0000012
268 Ga0496104_0061290
269 Ga0496106_0000092
270 Ga0496106_0365573
271 Ga0496107_0000031
272 Ga0496110_0003127
273 Ga0496117_0112086
274 Ga0496118_0052321
275 Ga0496126_0114901
276 Ga0501032_0021082
277 Ga0501033_0019091
278 Ga0501034_0110935
279 Ga0501034_0219018
280 Ga0501036_0064572
281 Ga0501038_0102592
282 Ga0501038_0192783
283 Ga0501039_0110899
284 Ga0501043_0033324
285 Ga0501046_0054545
286 Ga0501047_0161752
287 Ga0501048_0064789
288 Ga0501073_0068333
289 Ga0501076_0037878
290 Ga0501080_0145676
291 Ga0501083_0076698
292 Ga0501083_0157486
293 Ga0501044_0051397
294 nmdc:mga05p37_221038_c1
295 nmdc:mga08y16_338957_c1
296 Ga0500583_0066897
297 Ga0500634_0000603
298 Ga0500634_0076133
299 Ga0501084_0217909
300 2687582382
301 2871500968
302 2876385985
303 2881370208
304 2906661878
305 2929195722
306 2938016260
307 8004644331
308 8021625473

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13784

Fic_N

Fic/DOC family N-terminal

54

136

0.97

PF02661

Fic

Fic/DOC family

143

248

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f7p-assembly1.cif.gz_A rok repressor lmo0178 from listeria monocytogenes 0.8967 319 376
4ija-assembly1.cif.gz_B structure of s. aureus methicillin resistance factor mecr2 0.8957 319 376
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.8786 320 376
3eqx-assembly1.cif.gz_B crystal structure of a fic family protein (so_4266) from shewanella oneidensis at 1.6 a resolution 0.8767 26 385
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.873 323 376
ID Description Score Start End Superfamily
4ijaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8957 319 376 1.10.10.10
af_A0A0R4ISV4_565_710_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.8944 319 377 3.30.230.130
af_Q874R3_457_597_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.8796 320 376 3.30.230.130
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8786 320 376 1.10.10.10
4lb5B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.873 323 376 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3D1AWI3-F1-model_v4 Fic family protein 0.9818 229 390
AF-A0A480BWH2-F1-model_v4 Cell filamentation protein Fic 0.9802 165 383 GO:0003677
GO:0005524
GO:0006355
AF-A0A849TGZ5-F1-model_v4 Fic family protein 0.978 4 390 GO:0005524
AF-A0A3B9HS69-F1-model_v4 Cell filamentation protein Fic 0.9777 235 386
AF-F2A2R0-F1-model_v4 deleted 0.9754 120 390

Map