F218937

General Info

Members Datasets Scaffolds Average Seq Length
154 106 308 82

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_11224638|Ga0070709_112246382
Length 97
Sequence MSVIQWLPAGNYKIGSVNVRLLYFAVLRDITGKREAALSLPAGTRASDVWQQLRRDYAQLADYAQPPMIAVNETYATADTVLRDGDELAFIPPVAGG

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
86 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
90 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
93 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
94 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
95 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
96 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
97 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
98 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
99 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
100 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
101 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
102 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
103 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
104 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
105 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
106 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 94.16
Stem 0
Stem Tuber 0
Unclassified 22.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_11224638 3300005434 Unclassified 604
2 Ga0070676_11001564 3300005328 Unclassified 627
3 Ga0070676_11077377 3300005328 Unclassified 606
4 Ga0070683_100000061 3300005329 Bacteria 80712
5 Ga0070670_100000205 3300005331 Bacteria 54998
6 Ga0070670_100220275 3300005331 Bacteria 1651
7 Ga0070677_10667040 3300005333 Bacteria 582
8 Ga0068869_100748276 3300005334 Bacteria 837
9 Ga0070682_100000021 3300005337 Bacteria 215101
10 Ga0068868_100000132 3300005338 Bacteria 47927
11 Ga0068868_100002295 3300005338 Bacteria 13229
12 Ga0070689_100146359 3300005340 Bacteria 1903
13 Ga0070689_100271499 3300005340 Unclassified 1404
14 Ga0070689_100342545 3300005340 Bacteria 1252
15 Ga0070689_100389473 3300005340 Bacteria 1176
16 Ga0070687_100002150 3300005343 Bacteria 7291
17 Ga0070687_100388754 3300005343 Unclassified 911
18 Ga0070675_100000003 3300005354 Bacteria 422595
19 Ga0070673_100361207 3300005364 Unclassified 1291
20 Ga0070703_10126972 3300005406 Unclassified 932
21 Ga0070710_10825152 3300005437 Bacteria 664
22 Ga0070705_100738504 3300005440 Bacteria 777
23 Ga0070708_100660995 3300005445 Unclassified 984
24 Ga0070685_10022971 3300005466 Bacteria 3408
25 Ga0070706_100481526 3300005467 Unclassified 1154
26 Ga0070707_100005363 3300005468 Bacteria 11994
27 Ga0070699_100763490 3300005518 Unclassified 884
28 Ga0070684_100000264 3300005535 Bacteria 36253
29 Ga0070684_100872829 3300005535 Bacteria 842
30 Ga0070697_100064318 3300005536 Bacteria 2996
31 Ga0070697_101337512 3300005536 Bacteria 639
32 Ga0070672_100000178 3300005543 Bacteria 34773
33 Ga0070696_100477867 3300005546 Bacteria 988
34 Ga0070704_100916129 3300005549 Unclassified 789
35 Ga0068854_100067675 3300005578 Bacteria 2602
36 Ga0068854_100445403 3300005578 Bacteria 1080
37 Ga0070702_100079961 3300005615 Bacteria 1955
38 Ga0070702_100726055 3300005615 Unclassified 760
39 Ga0068852_102323650 3300005616 Bacteria 557
40 Ga0068859_100808072 3300005617 Unclassified 1025
41 Ga0068859_103092894 3300005617 Unclassified 507
42 Ga0068864_100000001 3300005618 Bacteria 686767
43 Ga0068861_100046155 3300005719 Bacteria 3283
44 Ga0068851_10962625 3300005834 Bacteria 537
45 Ga0068870_10381532 3300005840 Bacteria 912
46 Ga0068858_100000517 3300005842 Bacteria 40504
47 Ga0068858_100362584 3300005842 Bacteria 1389
48 Ga0068871_100213317 3300006358 Bacteria 1670
49 Ga0068871_100413049 3300006358 Bacteria 1204
50 Ga0075428_101985948 3300006844 Unclassified 603
51 Ga0075431_100057718 3300006847 Bacteria 4004
52 Ga0075433_10198271 3300006852 Bacteria 1785
53 Ga0075434_102140748 3300006871 Bacteria 564
54 Ga0075429_100037956 3300006880 Bacteria 4193
55 Ga0075429_100610628 3300006880 Bacteria 956
56 Ga0068865_100154684 3300006881 Bacteria 1743
57 Ga0068865_102145606 3300006881 Bacteria 508
58 Ga0097620_100808207 3300006931 Unclassified 1025
59 Ga0097620_103093235 3300006931 Unclassified 507
60 Ga0111539_10000003 3300009094 Bacteria 880006
61 Ga0105245_10002317 3300009098 Bacteria 17226
62 Ga0105245_11264459 3300009098 Bacteria 787
63 Ga0114129_10347838 3300009147 Bacteria 1965
64 Ga0114129_11912310 3300009147 Bacteria 719
65 Ga0105242_10001816 3300009176 Bacteria 16767
66 Ga0105238_10000008 3300009551 Bacteria 307196
67 Ga0157371_10358848 3300013102 Bacteria 1062
68 Ga0157369_10000317 3300013105 Bacteria 64962
69 Ga0157374_10000072 3300013296 Bacteria 102276
70 Ga0157375_10000010 3300013308 Bacteria 361011
71 Ga0157375_10000077 3300013308 Bacteria 100528
72 Ga0157375_10001447 3300013308 Bacteria 20422
73 Ga0157375_13373824 3300013308 Unclassified 532
74 Ga0157377_10000011 3300014745 Bacteria 305350
75 Ga0157377_10000480 3300014745 Bacteria 17222
76 Ga0157377_10368793 3300014745 Bacteria 969
77 Ga0157377_10802482 3300014745 Unclassified 694
78 Ga0157376_10000002 3300014969 Bacteria 684532
79 Ga0157376_10106657 3300014969 Bacteria 2458
80 Ga0213873_10000001 3300021358 Bacteria 1657979
81 Ga0213873_10001131 3300021358 Bacteria 4361
82 Ga0213876_10000015 3300021384 Bacteria 304025
83 Ga0213876_10000018 3300021384 Bacteria 282299
84 Ga0213876_10265906 3300021384 Bacteria 911
85 Ga0207653_10099557 3300025885 Unclassified 1027
86 Ga0207643_10301639 3300025908 Bacteria 997
87 Ga0207705_11073030 3300025909 Bacteria 621
88 Ga0207684_10104626 3300025910 Bacteria 2421
89 Ga0207662_10010040 3300025918 Bacteria 5222
90 Ga0207646_10014018 3300025922 Bacteria 7629
91 Ga0207646_10840547 3300025922 Bacteria 816
92 Ga0207694_10000001 3300025924 Bacteria 4078485
93 Ga0207650_10000251 3300025925 Bacteria 58147
94 Ga0207650_10442724 3300025925 Bacteria 1080
95 Ga0207659_10000006 3300025926 Bacteria 384976
96 Ga0207659_11832375 3300025926 Unclassified 515
97 Ga0207687_10009093 3300025927 Bacteria 6496
98 Ga0207687_10134549 3300025927 Bacteria 1868
99 Ga0207687_10924403 3300025927 Bacteria 747
100 Ga0207686_10000987 3300025934 Bacteria 16937
101 Ga0207670_10043988 3300025936 Bacteria 2952
102 Ga0207670_10117847 3300025936 Bacteria 1925
103 Ga0207670_10752552 3300025936 Bacteria 809
104 Ga0207691_10000626 3300025940 Bacteria 35026
105 Ga0207689_10221510 3300025942 Bacteria 1563
106 Ga0207661_10000002 3300025944 Bacteria 816104
107 Ga0207651_10028119 3300025960 Bacteria 3542
108 Ga0207640_10016496 3300025981 Bacteria 4298
109 Ga0207640_10025852 3300025981 Bacteria 3559
110 Ga0207640_10572936 3300025981 Bacteria 952
111 Ga0207677_10000003 3300026023 Bacteria 450061
112 Ga0207677_10000277 3300026023 Bacteria 38443
113 Ga0207703_10000085 3300026035 Bacteria 107333
114 Ga0207639_10127267 3300026041 Bacteria 2103
115 Ga0207708_11343874 3300026075 Bacteria 626
116 Ga0207676_10000002 3300026095 Bacteria 1198607
117 Ga0207674_10006599 3300026116 Bacteria 13636
118 Ga0207675_100076353 3300026118 Bacteria 3137
119 Ga0207683_11763241 3300026121 Unclassified 568
120 Ga0207698_11461138 3300026142 Bacteria 699
121 Ga0207428_10000001 3300027907 Bacteria 1034622
122 Ga0307407_11528813 3300031903 Unclassified 528
123 Ga0307416_100728507 3300032002 Bacteria 1083
124 Ga0307416_102667112 3300032002 Bacteria 597
125 Ga0373932_0000314 3300035112 Bacteria 14732
126 Ga0373943_0778798 3300035170 Unclassified 569
127 Ga0395900_1428503 3300037418 Bacteria 605
128 Ga0436365_0084958 3300039437 Bacteria 74213
129 Ga0436365_0142374 3300039437 Bacteria 217743
130 Ga0436365_0522556 3300039437 Unclassified 744
131 Ga0436365_1250685 3300039437 Bacteria 18064
132 Ga0436365_1376131 3300039437 Unclassified 797
133 Ga0436362_0011905 3300039453 Bacteria 5245
134 Ga0436362_0273161 3300039453 Bacteria 561309
135 Ga0451839_0205224 3300041496 Bacteria 1837
136 Ga0466963_0284635 3300044694 Bacteria 1162
137 Ga0495620_0000243 3300046515 Bacteria 40684
138 Ga0495621_0405461 3300046539 Unclassified 579
139 Ga0495588_0538300 3300046674 Bacteria 612
140 Ga0501299_077460 3300049522 Unclassified 733
141 Ga0501072_1551312 3300049588 Unclassified 511
142 Ga0501073_0034067 3300049589 Bacteria 3625
143 Ga0501074_0452190 3300049590 Unclassified 911
144 Ga0501080_0008345 3300049742 Bacteria 9380
145 Ga0501081_0408195 3300049743 Bacteria 1006
146 nmdc:mga09592_1526198_c1 3300050508 Unclassified 543
147 nmdc:mga09592_1571600_c1 3300050508 Unclassified 533
148 nmdc:mga09592_75894_c1 3300050508 Unclassified 2858
149 nmdc:mga0qj67_720329_c1 3300050509 Unclassified 793
150 nmdc:mga06r32_44069_c1 3300050510 Bacteria 4247
151 nmdc:mga08y16_1_c1 3300050511 Bacteria 1034622
152 nmdc:mga0n895_53951_c1 3300050512 Unclassified 3951
153 nmdc:mga0n895_550550_c1 3300050512 Bacteria 1159
154 nmdc:mga0a205_215038_c1 3300050515 Bacteria 1809
155 Ga0070709_11224638
156 Ga0070676_11001564
157 Ga0070676_11077377
158 Ga0070683_100000061
159 Ga0070670_100000205
160 Ga0070670_100220275
161 Ga0070677_10667040
162 Ga0068869_100748276
163 Ga0070682_100000021
164 Ga0068868_100000132
165 Ga0068868_100002295
166 Ga0070689_100146359
167 Ga0070689_100271499
168 Ga0070689_100342545
169 Ga0070689_100389473
170 Ga0070687_100002150
171 Ga0070687_100388754
172 Ga0070675_100000003
173 Ga0070673_100361207
174 Ga0070703_10126972
175 Ga0070710_10825152
176 Ga0070705_100738504
177 Ga0070708_100660995
178 Ga0070685_10022971
179 Ga0070706_100481526
180 Ga0070707_100005363
181 Ga0070699_100763490
182 Ga0070684_100000264
183 Ga0070684_100872829
184 Ga0070697_100064318
185 Ga0070697_101337512
186 Ga0070672_100000178
187 Ga0070696_100477867
188 Ga0070704_100916129
189 Ga0068854_100067675
190 Ga0068854_100445403
191 Ga0070702_100079961
192 Ga0070702_100726055
193 Ga0068852_102323650
194 Ga0068859_100808072
195 Ga0068859_103092894
196 Ga0068864_100000001
197 Ga0068861_100046155
198 Ga0068851_10962625
199 Ga0068870_10381532
200 Ga0068858_100000517
201 Ga0068858_100362584
202 Ga0068871_100213317
203 Ga0068871_100413049
204 Ga0075428_101985948
205 Ga0075431_100057718
206 Ga0075433_10198271
207 Ga0075434_102140748
208 Ga0075429_100037956
209 Ga0075429_100610628
210 Ga0068865_100154684
211 Ga0068865_102145606
212 Ga0097620_100808207
213 Ga0097620_103093235
214 Ga0111539_10000003
215 Ga0105245_10002317
216 Ga0105245_11264459
217 Ga0114129_10347838
218 Ga0114129_11912310
219 Ga0105242_10001816
220 Ga0105238_10000008
221 Ga0157371_10358848
222 Ga0157369_10000317
223 Ga0157374_10000072
224 Ga0157375_10000010
225 Ga0157375_10000077
226 Ga0157375_10001447
227 Ga0157375_13373824
228 Ga0157377_10000011
229 Ga0157377_10000480
230 Ga0157377_10368793
231 Ga0157377_10802482
232 Ga0157376_10000002
233 Ga0157376_10106657
234 Ga0213873_10000001
235 Ga0213873_10001131
236 Ga0213876_10000015
237 Ga0213876_10000018
238 Ga0213876_10265906
239 Ga0207653_10099557
240 Ga0207643_10301639
241 Ga0207705_11073030
242 Ga0207684_10104626
243 Ga0207662_10010040
244 Ga0207646_10014018
245 Ga0207646_10840547
246 Ga0207694_10000001
247 Ga0207650_10000251
248 Ga0207650_10442724
249 Ga0207659_10000006
250 Ga0207659_11832375
251 Ga0207687_10009093
252 Ga0207687_10134549
253 Ga0207687_10924403
254 Ga0207686_10000987
255 Ga0207670_10043988
256 Ga0207670_10117847
257 Ga0207670_10752552
258 Ga0207691_10000626
259 Ga0207689_10221510
260 Ga0207661_10000002
261 Ga0207651_10028119
262 Ga0207640_10016496
263 Ga0207640_10025852
264 Ga0207640_10572936
265 Ga0207677_10000003
266 Ga0207677_10000277
267 Ga0207703_10000085
268 Ga0207639_10127267
269 Ga0207708_11343874
270 Ga0207676_10000002
271 Ga0207674_10006599
272 Ga0207675_100076353
273 Ga0207683_11763241
274 Ga0207698_11461138
275 Ga0207428_10000001
276 Ga0307407_11528813
277 Ga0307416_100728507
278 Ga0307416_102667112
279 Ga0373932_0000314
280 Ga0373943_0778798
281 Ga0395900_1428503
282 Ga0436365_0084958
283 Ga0436365_0142374
284 Ga0436365_0522556
285 Ga0436365_1250685
286 Ga0436365_1376131
287 Ga0436362_0011905
288 Ga0436362_0273161
289 Ga0451839_0205224
290 Ga0466963_0284635
291 Ga0495620_0000243
292 Ga0495621_0405461
293 Ga0495588_0538300
294 Ga0501299_077460
295 Ga0501072_1551312
296 Ga0501073_0034067
297 Ga0501074_0452190
298 Ga0501080_0008345
299 Ga0501081_0408195
300 nmdc:mga09592_1526198_c1
301 nmdc:mga09592_1571600_c1
302 nmdc:mga09592_75894_c1
303 nmdc:mga0qj67_720329_c1
304 nmdc:mga06r32_44069_c1
305 nmdc:mga08y16_1_c1
306 nmdc:mga0n895_53951_c1
307 nmdc:mga0n895_550550_c1
308 nmdc:mga0a205_215038_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

21

97

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jbz-assembly1.cif.gz_D structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8994 3 84
6jc0-assembly1.cif.gz_A structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8862 4 84
2m19-assembly1.cif.gz_A solution structure of the haloferax volcanii hvo 2177 protein 0.8764 4 84
1vjk-assembly1.cif.gz_A putative molybdopterin converting factor, subunit 1 from pyrococcus furiosus, pfu-562899-001 0.8627 4 81
4hro-assembly1.cif.gz_A crystal structure of h. volcanii small archaeal modifier protein 1 0.8601 4 81
ID Description Score Start End Superfamily
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9051 7 81 3.10.20.30
af_I6XWG2_11_92_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9047 4 84 3.10.20.30
af_I6XWG2_11_92_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8843 4 84 3.10.20.30
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8832 7 81 3.10.20.30
af_A0A0B4J391_26_106_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.88 5 84 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A2V7YP23-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9858 4 84 GO:0000166
GO:0006777
GO:1990133
AF-A0A2V7YP23-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9739 4 84 GO:0000166
GO:0006777
GO:1990133
AF-A0A178LVU5-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9558 4 84 GO:0000166
GO:0006777
GO:1990133
AF-D1CDP8-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9519 4 84 GO:0000166
GO:0006777
GO:1990133
AF-A0A401IFE7-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9507 1 84 GO:0006777
GO:0016020
GO:1990133

Map