F218914

General Info

Members Datasets Scaffolds Average Seq Length
154 119 308 234

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100096551|Ga0070667_1000965513
Length 260
Sequence MLSSRRSRKWRMPLRVDILTLFPEMFGPFIGTSIPKRAADKGLVEYHLTNIRNFATDAHQSVDDKPFGGGPGMVMMCQTMYDAVDSVEQQDTRPATRIILTPQGRRFDEDLAKDLATKPRLLLISGRYEGFDERIIDGLKPMELSIGDYVLSGGELAAMVIIDAVVRLIPGVLGAEQGAADESFADGLLEHPQYTRPREYRGMSVPDILLSGDHSKIAKWRLEQRKLRTQERRPDLWETYLQRDGNRQHGVNPPGDRPTD

Samples

Sample ID Description Type Environment
1 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
6 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
12 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
23 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
31 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
32 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
34 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
54 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
55 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
56 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
57 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
58 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
59 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
60 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
62 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
63 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
64 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
65 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
66 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
67 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
68 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
69 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
70 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
71 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
72 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
73 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
74 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
75 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
76 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
77 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
78 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
79 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
80 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
81 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
82 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
83 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
84 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
97 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
98 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
99 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
100 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
101 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
102 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
103 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
104 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
105 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
106 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
108 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
109 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
110 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
111 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
112 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
113 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
114 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
115 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
116 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
117 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
119 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.75
Metatranscriptomes 3.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 0
Rhizosphere 98.7
Stem 0
Stem Tuber 0
Unclassified 7.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070667_100096551 3300005367 Bacteria 2549
2 Ga0070690_100440021 3300005330 Bacteria 965
3 Ga0070680_100225880 3300005336 Bacteria 1581
4 Ga0070709_10475484 3300005434 Bacteria 945
5 Ga0070694_100027563 3300005444 Bacteria 3690
6 Ga0070663_100392289 3300005455 Bacteria 1133
7 Ga0070706_100003792 3300005467 Bacteria 14760
8 Ga0070665_100000445 3300005548 Bacteria 60164
9 Ga0070665_100004529 3300005548 Bacteria 14560
10 Ga0070664_100403368 3300005564 Bacteria 1250
11 Ga0068856_100554560 3300005614 Unclassified 1170
12 Ga0068856_100720401 3300005614 Bacteria 1018
13 Ga0068863_100199201 3300005841 Bacteria 1926
14 Ga0068863_100529878 3300005841 Bacteria 1162
15 Ga0068858_100334315 3300005842 Bacteria 1449
16 Ga0068860_100299149 3300005843 Bacteria 1576
17 Ga0081455_10031263 3300005937 Bacteria 4820
18 Ga0081539_10004420 3300005985 Bacteria 15558
19 Ga0070717_10203071 3300006028 Bacteria 1737
20 Ga0070717_10355168 3300006028 Bacteria 1311
21 Ga0075367_10173668 3300006178 Bacteria 1343
22 Ga0075428_100403154 3300006844 Bacteria 1465
23 Ga0075428_100501429 3300006844 Unclassified 1299
24 Ga0075428_100820142 3300006844 Bacteria 988
25 Ga0075430_100012729 3300006846 Bacteria 7169
26 Ga0075431_100031709 3300006847 Bacteria 5444
27 Ga0075431_100369667 3300006847 Bacteria 1439
28 Ga0075434_100158780 3300006871 Bacteria 2281
29 Ga0075434_100738618 3300006871 Bacteria 1001
30 Ga0075436_100034435 3300006914 Bacteria 3493
31 Ga0075435_100334106 3300007076 Bacteria 1298
32 Ga0111539_10325735 3300009094 Bacteria 1788
33 Ga0111539_10611078 3300009094 Bacteria 1270
34 Ga0111539_10684416 3300009094 Bacteria 1194
35 Ga0105241_10063152 3300009174 Bacteria 2856
36 Ga0105237_10662913 3300009545 Unclassified 1050
37 Ga0105238_10357145 3300009551 Bacteria 1450
38 Ga0105249_10616245 3300009553 Bacteria 1141
39 Ga0157369_10052655 3300013105 Bacteria 4403
40 Ga0163163_10395990 3300014325 Unclassified 1439
41 Ga0157379_10489367 3300014968 Bacteria 1139
42 Ga0206356_11755229 3300020070 Bacteria 1672
43 Ga0206355_1031635 3300020076 Bacteria 856
44 Ga0206355_1584857 3300020076 Bacteria 1650
45 Ga0207654_10089987 3300025911 Bacteria 1869
46 Ga0207660_10228457 3300025917 Bacteria 1463
47 Ga0207646_10394735 3300025922 Bacteria 1250
48 Ga0207650_10213591 3300025925 Bacteria 1550
49 Ga0207644_10047045 3300025931 Bacteria 3077
50 Ga0207686_10475869 3300025934 Bacteria 965
51 Ga0207704_10584930 3300025938 Bacteria 912
52 Ga0207691_10179104 3300025940 Bacteria 1853
53 Ga0207711_10233856 3300025941 Bacteria 1684
54 Ga0207658_10287990 3300025986 Bacteria 1411
55 Ga0207702_10117187 3300026078 Unclassified 2378
56 Ga0207641_10123782 3300026088 Bacteria 2312
57 Ga0207676_10060491 3300026095 Bacteria 2997
58 Ga0207698_10488765 3300026142 Bacteria 1196
59 Ga0268266_10001614 3300028379 Bacteria 26314
60 Ga0268266_10002432 3300028379 Bacteria 20015
61 Ga0268266_10648952 3300028379 Bacteria 1016
62 Ga0268264_10030907 3300028381 Bacteria 4391
63 Ga0265777_101861 3300030877 Bacteria 1171
64 Ga0265325_10054059 3300031241 Unclassified 2057
65 Ga0265327_10007489 3300031251 Bacteria 8417
66 Ga0316578_10158141 3300031728 Bacteria 1365
67 Ga0316583_10017068 3300032133 Bacteria 2612
68 Ga0373934_0117293 3300035086 Bacteria 1082
69 Ga0373943_0171985 3300035170 Bacteria 1186
70 Ga0373924_0042572 3300035410 Bacteria 1863
71 Ga0373935_0019703 3300035692 Unclassified 4114
72 Ga0373947_0042338 3300035725 Unclassified 2718
73 Ga0373937_0172125 3300036401 Unclassified 2032
74 Ga0373937_0257664 3300036401 Unclassified 1645
75 Ga0395905_0375616 3300037471 Bacteria 1315
76 Ga0451576_0000298 3300045051 Bacteria 120202
77 Ga0495592_0078525 3300046454 Bacteria 2391
78 Ga0495603_0052229 3300046455 Bacteria 2427
79 Ga0495651_0070011 3300046462 Bacteria 2670
80 Ga0495580_0010831 3300046472 Bacteria 7076
81 Ga0495580_0025913 3300046472 Bacteria 4280
82 Ga0495582_0021391 3300046473 Bacteria 3540
83 Ga0495582_0050104 3300046473 Bacteria 2301
84 Ga0495594_0150260 3300046499 Bacteria 1322
85 Ga0495608_0001127 3300046511 Bacteria 18907
86 Ga0495628_0248925 3300046516 Bacteria 1327
87 Ga0495652_0056553 3300046529 Bacteria 3331
88 Ga0495640_0205451 3300046533 Bacteria 1247
89 Ga0495586_0032088 3300046535 Bacteria 2816
90 Ga0495586_0143247 3300046535 Bacteria 1342
91 Ga0495645_0302679 3300046543 Bacteria 1044
92 Ga0495623_0128764 3300046679 Bacteria 1518
93 Ga0495646_0115307 3300046680 Bacteria 1525
94 Ga0495647_0045529 3300046681 Unclassified 1686
95 Ga0495613_0146623 3300046689 Bacteria 1684
96 Ga0495613_0179181 3300046689 Bacteria 1501
97 Ga0495604_0077648 3300047317 Bacteria 2495
98 Ga0495674_0091319 3300047319 Bacteria 2601
99 Ga0495680_0167863 3300047322 Bacteria 1590
100 Ga0495680_0297137 3300047322 Bacteria 1134
101 Ga0495686_0171487 3300047472 Bacteria 1261
102 Ga0496126_0109856 3300048929 Bacteria 2403
103 Ga0501031_0188847 3300049568 Bacteria 1345
104 Ga0501032_0001973 3300049569 Bacteria 16155
105 Ga0501033_0019825 3300049570 Bacteria 5083
106 Ga0501034_0000512 3300049571 Bacteria 62257
107 Ga0501034_0032564 3300049571 Bacteria 5292
108 Ga0501034_0075731 3300049571 Bacteria 3372
109 Ga0501034_0262810 3300049571 Bacteria 1668
110 Ga0501037_0219637 3300049573 Bacteria 1338
111 Ga0501038_0002681 3300049574 Bacteria 16620
112 Ga0501041_0022535 3300049577 Bacteria 3771
113 Ga0501042_0191850 3300049578 Bacteria 1474
114 Ga0501043_0049899 3300049579 Bacteria 3290
115 Ga0501046_0022259 3300049580 Bacteria 5222
116 Ga0501046_0096373 3300049580 Bacteria 2272
117 Ga0501047_0013402 3300049581 Bacteria 7772
118 Ga0501047_0015985 3300049581 Bacteria 7156
119 Ga0501047_0350593 3300049581 Bacteria 1313
120 Ga0501048_0161952 3300049582 Bacteria 1583
121 Ga0501068_0017711 3300049584 Bacteria 4121
122 Ga0501069_0000131 3300049585 Bacteria 32685
123 Ga0501070_0000547 3300049586 Bacteria 34386
124 Ga0501070_0007187 3300049586 Bacteria 9454
125 Ga0501071_0189177 3300049587 Bacteria 1543
126 Ga0501073_0138207 3300049589 Bacteria 1688
127 Ga0501074_0006094 3300049590 Bacteria 8706
128 Ga0501079_0264059 3300049741 Bacteria 1345
129 Ga0501080_0023262 3300049742 Bacteria 5745
130 Ga0501080_0088333 3300049742 Bacteria 2880
131 Ga0501080_0145991 3300049742 Bacteria 2186
132 Ga0501080_0710781 3300049742 Bacteria 886
133 Ga0501081_0207393 3300049743 Bacteria 1422
134 Ga0501083_0022173 3300049744 Bacteria 4407
135 Ga0501083_0196892 3300049744 Bacteria 1315
136 Ga0501035_0006635 3300049822 Bacteria 10831
137 Ga0501044_0000355 3300049823 Bacteria 57341
138 Ga0501044_0014281 3300049823 Bacteria 8574
139 Ga0501044_0227470 3300049823 Bacteria 1814
140 nmdc:mga0qj67_607410_c1 3300050509 Bacteria 875
141 nmdc:mga06r32_100091_c1 3300050510 Bacteria 2844
142 nmdc:mga08y16_257682_c1 3300050511 Bacteria 1802
143 nmdc:mga0n895_89994_c1 3300050512 Bacteria 3070
144 nmdc:mga0rr50_1111210_c1 3300050513 Bacteria 672
145 nmdc:mga0a205_30544_c1 3300050515 Bacteria 5159
146 Ga0495601_0000846 3300053077 Bacteria 16649
147 Ga0495601_0004218 3300053077 Bacteria 8292
148 Ga0495595_0019406 3300053084 Bacteria 2949
149 Ga0495619_0007282 3300053085 Bacteria 7006
150 Ga0495619_0214502 3300053085 Bacteria 1333
151 Ga0587077_018496 3300059493 Bacteria 1201
152 Ga0501082_0037835 3300060353 Bacteria 4161
153 Ga0501082_0055966 3300060353 Bacteria 3397
154 Ga0530510_0030839 3300061734 Bacteria 3852
155 Ga0070667_100096551
156 Ga0070690_100440021
157 Ga0070680_100225880
158 Ga0070709_10475484
159 Ga0070694_100027563
160 Ga0070663_100392289
161 Ga0070706_100003792
162 Ga0070665_100000445
163 Ga0070665_100004529
164 Ga0070664_100403368
165 Ga0068856_100554560
166 Ga0068856_100720401
167 Ga0068863_100199201
168 Ga0068863_100529878
169 Ga0068858_100334315
170 Ga0068860_100299149
171 Ga0081455_10031263
172 Ga0081539_10004420
173 Ga0070717_10203071
174 Ga0070717_10355168
175 Ga0075367_10173668
176 Ga0075428_100403154
177 Ga0075428_100501429
178 Ga0075428_100820142
179 Ga0075430_100012729
180 Ga0075431_100031709
181 Ga0075431_100369667
182 Ga0075434_100158780
183 Ga0075434_100738618
184 Ga0075436_100034435
185 Ga0075435_100334106
186 Ga0111539_10325735
187 Ga0111539_10611078
188 Ga0111539_10684416
189 Ga0105241_10063152
190 Ga0105237_10662913
191 Ga0105238_10357145
192 Ga0105249_10616245
193 Ga0157369_10052655
194 Ga0163163_10395990
195 Ga0157379_10489367
196 Ga0206356_11755229
197 Ga0206355_1031635
198 Ga0206355_1584857
199 Ga0207654_10089987
200 Ga0207660_10228457
201 Ga0207646_10394735
202 Ga0207650_10213591
203 Ga0207644_10047045
204 Ga0207686_10475869
205 Ga0207704_10584930
206 Ga0207691_10179104
207 Ga0207711_10233856
208 Ga0207658_10287990
209 Ga0207702_10117187
210 Ga0207641_10123782
211 Ga0207676_10060491
212 Ga0207698_10488765
213 Ga0268266_10001614
214 Ga0268266_10002432
215 Ga0268266_10648952
216 Ga0268264_10030907
217 Ga0265777_101861
218 Ga0265325_10054059
219 Ga0265327_10007489
220 Ga0316578_10158141
221 Ga0316583_10017068
222 Ga0373934_0117293
223 Ga0373943_0171985
224 Ga0373924_0042572
225 Ga0373935_0019703
226 Ga0373947_0042338
227 Ga0373937_0172125
228 Ga0373937_0257664
229 Ga0395905_0375616
230 Ga0451576_0000298
231 Ga0495592_0078525
232 Ga0495603_0052229
233 Ga0495651_0070011
234 Ga0495580_0010831
235 Ga0495580_0025913
236 Ga0495582_0021391
237 Ga0495582_0050104
238 Ga0495594_0150260
239 Ga0495608_0001127
240 Ga0495628_0248925
241 Ga0495652_0056553
242 Ga0495640_0205451
243 Ga0495586_0032088
244 Ga0495586_0143247
245 Ga0495645_0302679
246 Ga0495623_0128764
247 Ga0495646_0115307
248 Ga0495647_0045529
249 Ga0495613_0146623
250 Ga0495613_0179181
251 Ga0495604_0077648
252 Ga0495674_0091319
253 Ga0495680_0167863
254 Ga0495680_0297137
255 Ga0495686_0171487
256 Ga0496126_0109856
257 Ga0501031_0188847
258 Ga0501032_0001973
259 Ga0501033_0019825
260 Ga0501034_0000512
261 Ga0501034_0032564
262 Ga0501034_0075731
263 Ga0501034_0262810
264 Ga0501037_0219637
265 Ga0501038_0002681
266 Ga0501041_0022535
267 Ga0501042_0191850
268 Ga0501043_0049899
269 Ga0501046_0022259
270 Ga0501046_0096373
271 Ga0501047_0013402
272 Ga0501047_0015985
273 Ga0501047_0350593
274 Ga0501048_0161952
275 Ga0501068_0017711
276 Ga0501069_0000131
277 Ga0501070_0000547
278 Ga0501070_0007187
279 Ga0501071_0189177
280 Ga0501073_0138207
281 Ga0501074_0006094
282 Ga0501079_0264059
283 Ga0501080_0023262
284 Ga0501080_0088333
285 Ga0501080_0145991
286 Ga0501080_0710781
287 Ga0501081_0207393
288 Ga0501083_0022173
289 Ga0501083_0196892
290 Ga0501035_0006635
291 Ga0501044_0000355
292 Ga0501044_0014281
293 Ga0501044_0227470
294 nmdc:mga0qj67_607410_c1
295 nmdc:mga06r32_100091_c1
296 nmdc:mga08y16_257682_c1
297 nmdc:mga0n895_89994_c1
298 nmdc:mga0rr50_1111210_c1
299 nmdc:mga0a205_30544_c1
300 Ga0495601_0000846
301 Ga0495601_0004218
302 Ga0495595_0019406
303 Ga0495619_0007282
304 Ga0495619_0214502
305 Ga0587077_018496
306 Ga0501082_0037835
307 Ga0501082_0055966
308 Ga0530510_0030839

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01746

tRNA_m1G_MT

tRNA (Guanine-1)-methyltransferase

35

234

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yvg-assembly1.cif.gz_A crystal structure of h. influenzae trmd in complex with adomet 0.9641 3 227
6jki-assembly1.cif.gz_A crystal structure and catalytic mechanism of the essential m1g37 trna methyltransferase trmd from pseudomonas aeruginosa 0.9635 3 228
4yq7-assembly1.cif.gz_A crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds 0.9633 2 227
1uaj-assembly1.cif.gz_A-2 crystal structure of trna(m1g37)methyltransferase: insight into trna recognition 0.9624 2 225
5wyq-assembly1.cif.gz_A crystal structure and catalytic mechanism of the essential m1g37 trna methyltransferase trmd from pseudomonas aeruginosa 0.9622 3 228
ID Description Score Start End Superfamily
af_Q2FZ43_163_244_1.10.1270.20 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9976 169 229 1.10.1270.20
af_P0A873_166_255_1.10.1270.20 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9908 169 227 1.10.1270.20
3quvB02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9888 176 225 1.10.1270.20
1uamA02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9886 172 228 1.10.1270.20
4yvkA02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9861 171 225 1.10.1270.20
ID Description Score Start End GO Terms
AF-X0WFB3-F1-model_v4 tRNA methyltransferase TRMD/TRM10-type domain-containing protein 0.986 1 154 GO:0002939
GO:0005829
GO:0052906
AF-A0A7C4GEK1-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) 0.9815 3 225 GO:0002939
GO:0005829
GO:0052906
AF-A0A7S6S192-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) 0.9812 3 225 GO:0002939
GO:0005829
GO:0052906
AF-A0A0S7WLI2-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) 0.9801 25 228 GO:0002939
GO:0005829
GO:0052906
AF-A0A847I273-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) 0.98 3 229 GO:0002939
GO:0005829
GO:0052906

Map