F217495

General Info

Members Datasets Scaffolds Average Seq Length
153 125 145 170

Family's Representative Sequence

Representative Sequence 3300035116|Ga0373945_0032795|Ga0373945_0032795_404_979
Length 191
Sequence VAPVREPQEELVSEPFLGEIRIFGFSFAPKGWALCAGQTLPINQNAALFSLLGTTYGGNGQTTFQLPDLQGRVVLSSGQGPGLTNRNLGEKLGSASVALTTQQMPLHNHPVNCTNLPGSLTGNPLGNPANQVWAADAGGVTQEYAPPSANLQAMDPRAIGNTGSGLPHENQTPYLVINYSIALQGIFPTRN

Samples

Sample ID Description Type Environment
1 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
2 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
3 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
4 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
5 2919085039 Luteibacter sp. 1214 Isolate Unclassified
6 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
7 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
39 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
45 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
46 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
58 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
59 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
60 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
61 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
62 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
63 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
64 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
65 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
66 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
67 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
68 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
69 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
73 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
74 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
75 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
76 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
77 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
78 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
83 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
84 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
85 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
86 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
87 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
88 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
89 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
90 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
91 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
92 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
93 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
94 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
95 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
96 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
97 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
98 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
114 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
115 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
116 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
117 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
118 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
119 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
120 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
121 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
122 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
123 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
125 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.16
Metatranscriptomes 2.61
Isolates 5.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.46
Nodule 2.61
Rhizoplane 1.96
Rhizosphere 75.16
Stem 0
Stem Tuber 0
Unclassified 9.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10066339 3300003323 Bacteria 7662
2 Ga0055535_1000123 3300003761 Bacteria 83521
3 Ga0055529_1000159 3300003763 Bacteria 93013
4 Ga0058863_11734117 3300004799 Unclassified 1269
5 Ga0058861_11892879 3300004800 Bacteria 1301
6 Ga0058862_10112573 3300004803 Bacteria 1073
7 Ga0070658_10000096 3300005327 Bacteria 77523
8 Ga0070658_10000519 3300005327 Bacteria 33450
9 Ga0070670_100024409 3300005331 Bacteria 5199
10 Ga0070680_100200220 3300005336 Unclassified 1684
11 Ga0070709_10069656 3300005434 Bacteria 2266
12 Ga0070713_101070766 3300005436 Bacteria 779
13 Ga0070706_100014913 3300005467 Bacteria 7178
14 Ga0070706_100589574 3300005467 Bacteria 1033
15 Ga0070707_100132030 3300005468 Bacteria 2428
16 Ga0070698_100080253 3300005471 Bacteria 3257
17 Ga0070699_100224132 3300005518 Bacteria 1676
18 Ga0070679_100696975 3300005530 Bacteria 958
19 Ga0070697_100029688 3300005536 Unclassified 4386
20 Ga0070697_100467276 3300005536 Bacteria 1100
21 Ga0068855_100000086 3300005563 Bacteria 111462
22 Ga0068855_100256897 3300005563 Unclassified 1948
23 Ga0068858_100765101 3300005842 Unclassified 941
24 Ga0075365_10031839 3300006038 Bacteria 3386
25 Ga0075428_100009880 3300006844 Bacteria 10605
26 Ga0075431_100019275 3300006847 Bacteria 6954
27 Ga0105240_10000002 3300009093 Bacteria 1924170
28 Ga0105240_10003040 3300009093 Bacteria 26390
29 Ga0105240_10004382 3300009093 Bacteria 21554
30 Ga0105240_11069548 3300009093 Bacteria 860
31 Ga0114129_10221149 3300009147 Bacteria 2554
32 Ga0114129_11066493 3300009147 Bacteria 1013
33 Ga0105249_10918679 3300009553 Unclassified 942
34 Ga0105239_10304861 3300010375 Unclassified 1794
35 Ga0157370_10000484 3300013104 Bacteria 49539
36 Ga0157378_10052127 3300013297 Bacteria 3640
37 Ga0157380_10517980 3300014326 Bacteria 1162
38 Ga0157376_10005919 3300014969 Bacteria 8584
39 Ga0213873_10086766 3300021358 Unclassified 883
40 Ga0213874_10016801 3300021377 Unclassified 1954
41 Ga0213876_10194411 3300021384 Viruses 1078
42 Ga0209563_108811 3300025230 Unclassified 1568
43 Ga0209258_100060 3300025242 Bacteria 319881
44 Ga0209148_1003371 3300025254 Bacteria 4471
45 Ga0209759_1000282 3300025256 Bacteria 71259
46 Ga0209129_1000835 3300025258 Bacteria 19351
47 Ga0209455_1000136 3300025272 Bacteria 146375
48 Ga0209758_1029974 3300025297 Bacteria 2262
49 Ga0207699_10722182 3300025906 Bacteria 730
50 Ga0207705_10000141 3300025909 Bacteria 77000
51 Ga0207705_10016217 3300025909 Bacteria 5343
52 Ga0207684_11004123 3300025910 Bacteria 698
53 Ga0207695_10000002 3300025913 Bacteria 2188391
54 Ga0207695_10011071 3300025913 Bacteria 10955
55 Ga0207695_10016376 3300025913 Bacteria 8675
56 Ga0207660_10175176 3300025917 Unclassified 1663
57 Ga0207652_10051877 3300025921 Bacteria 3518
58 Ga0207652_10634751 3300025921 Bacteria 956
59 Ga0207646_10316667 3300025922 Bacteria 1410
60 Ga0207665_10468673 3300025939 Viruses 969
61 Ga0207667_10000229 3300025949 Bacteria 78821
62 Ga0265328_10011283 3300031239 Bacteria 3577
63 Ga0265327_10000499 3300031251 Bacteria 68183
64 Ga0265316_10502118 3300031344 Bacteria 866
65 Ga0307516_10000442 3300031730 Bacteria 54561
66 Ga0307412_10102143 3300031911 Bacteria 2030
67 Ga0373923_0512869 3300035111 Bacteria 585
68 Ga0373945_0032795 3300035116 Bacteria 1842
69 Ga0373945_0066252 3300035116 Bacteria 1358
70 Ga0373954_0128336 3300035118 Unclassified 1233
71 Ga0373955_0031560 3300035172 Bacteria 2776
72 Ga0373955_0471487 3300035172 Bacteria 766
73 Ga0373935_0575330 3300035692 Bacteria 822
74 Ga0373927_0012460 3300035695 Bacteria 5662
75 Ga0373927_0107862 3300035695 Bacteria 1814
76 Ga0373933_0015219 3300035724 Bacteria 4288
77 Ga0373933_0569153 3300035724 Unclassified 744
78 Ga0373947_0014783 3300035725 Bacteria 4479
79 Ga0373947_0083237 3300035725 Bacteria 1984
80 Ga0373947_0098950 3300035725 Unclassified 1830
81 Ga0373947_0598093 3300035725 Bacteria 752
82 Ga0373937_0010746 3300036401 Bacteria 8009
83 Ga0373937_0435811 3300036401 Unclassified 1244
84 Ga0373937_0912124 3300036401 Bacteria 827
85 Ga0373925_0000163 3300037068 Bacteria 71614
86 Ga0373925_0162604 3300037068 Bacteria 1759
87 Ga0436364_0461640 3300037853 Bacteria 4057
88 Ga0436365_0067640 3300039437 Bacteria 4346
89 Ga0436363_0434313 3300039450 Unclassified 922
90 Ga0436363_1033648 3300039450 Bacteria 2142
91 Ga0436362_0069014 3300039453 Bacteria 1232
92 Ga0436362_1167014 3300039453 Bacteria 2436
93 Ga0451577_0636558 3300042876 Bacteria 967
94 Ga0466969_0002995 3300044656 Bacteria 8997
95 Ga0453684_0013005 3300044712 Bacteria 13596
96 Ga0453684_0017394 3300044712 Bacteria 11140
97 Ga0466960_0082359 3300044901 Bacteria 1624
98 Ga0466958_0148657 3300045836 Bacteria 1477
99 Ga0495651_0003356 3300046462 Bacteria 12293
100 Ga0495653_0696703 3300046463 Bacteria 617
101 Ga0495639_0044096 3300046475 Bacteria 2016
102 Ga0495607_0000008 3300046501 Bacteria 265274
103 Ga0495608_0054941 3300046511 Bacteria 2632
104 Ga0495618_0742497 3300046514 Bacteria 575
105 Ga0495628_0296261 3300046516 Bacteria 1198
106 Ga0495630_0383512 3300046517 Bacteria 1077
107 Ga0495665_0419247 3300046531 Bacteria 678
108 Ga0495640_0275840 3300046533 Bacteria 1048
109 Ga0495640_0825046 3300046533 Unclassified 552
110 Ga0495587_0204930 3300046536 Bacteria 1115
111 Ga0495658_0569639 3300046683 Unclassified 725
112 Ga0495680_1085901 3300047322 Bacteria 506
113 Ga0496107_0439794 3300048910 Bacteria 969
114 Ga0496114_0100498 3300048917 Bacteria 2468
115 Ga0496114_0231817 3300048917 Bacteria 1622
116 Ga0496116_0151381 3300048919 Bacteria 1288
117 Ga0496123_0010946 3300048926 Bacteria 7936
118 Ga0501031_0012427 3300049568 Bacteria 5554
119 Ga0501032_0005377 3300049569 Bacteria 9528
120 Ga0501033_0022033 3300049570 Bacteria 4806
121 Ga0501034_0025516 3300049571 Bacteria 6018
122 Ga0501036_0017209 3300049572 Bacteria 6042
123 Ga0501038_0000458 3300049574 Bacteria 35717
124 Ga0501039_0047888 3300049575 Bacteria 3305
125 Ga0501042_0220363 3300049578 Unclassified 1368
126 Ga0501043_0006193 3300049579 Bacteria 9613
127 Ga0501046_0008197 3300049580 Bacteria 9129
128 Ga0501047_0008294 3300049581 Bacteria 9805
129 Ga0501048_0029473 3300049582 Bacteria 3981
130 Ga0501073_0004594 3300049589 Bacteria 10375
131 Ga0501080_0032762 3300049742 Bacteria 4848
132 Ga0501035_0018433 3300049822 Bacteria 6431
133 Ga0501044_0076536 3300049823 Unclassified 3395
134 nmdc:mga0yw44_143124_c1 3300050492 Bacteria 1555
135 nmdc:mga0yw44_395626_c1 3300050492 Bacteria 934
136 nmdc:mga0rr50_33889_c1 3300050513 Bacteria 3652
137 Ga0495612_0370449 3300053078 Bacteria 648
138 Ga0500610_0015135 3300053079 Bacteria 3642
139 Ga0495619_0655080 3300053085 Bacteria 716
140 Ga0500644_0004644 3300053088 Bacteria 3445
141 Ga0500651_0022663 3300053093 Bacteria 3925
142 Ga0500658_0250030 3300053134 Bacteria 815
143 Ga0500559_0010278 3300053136 Unclassified 4022
144 Ga0587111_0076026 3300060346 Bacteria 793
145 Ga0530510_0627371 3300061734 Unclassified 818

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047322 Ga0495680_1085901 Ga0495680_1085901_33_452 139
2 3300049578 Ga0501042_0220363 Ga0501042_0220363_864_1298 139
3 3300035111 Ga0373923_0512869 Ga0373923_0512869_58_501 143
4 3300035116 Ga0373945_0066252 Ga0373945_0066252_814_1257 143
5 3300035695 Ga0373927_0107862 Ga0373927_0107862_1045_1488 143
6 3300035724 Ga0373933_0569153 Ga0373933_0569153_35_478 143
7 3300036401 Ga0373937_0912124 Ga0373937_0912124_351_794 143
8 3300046463 Ga0495653_0696703 Ga0495653_0696703_145_588 143
9 3300046514 Ga0495618_0742497 Ga0495618_0742497_31_474 143
10 3300046533 Ga0495640_0825046 Ga0495640_0825046_29_472 143
11 3300053078 Ga0495612_0370449 Ga0495612_0370449_28_471 143
12 3300053085 Ga0495619_0655080 Ga0495619_0655080_216_659 143
13 3300039453 Ga0436362_0069014 Ga0436362_0069014_602_1114 148
14 3300021358 Ga0213873_10086766 Ga0213873_100867662 153
15 3300021377 Ga0213874_10016801 Ga0213874_100168012 153
16 3300021384 Ga0213876_10194411 Ga0213876_101944112 153
17 3300037853 Ga0436364_0461640 Ga0436364_0461640_1537_2049 153
18 3300039437 Ga0436365_0067640 Ga0436365_0067640_263_775 153
19 3300039450 Ga0436363_1033648 Ga0436363_1033648_491_1003 153
20 3300039453 Ga0436362_1167014 Ga0436362_1167014_1090_1602 153
21 3300050513 nmdc:mga0rr50_33889_c1 nmdc:mga0rr50_33889_c1_1710_2180 156
22 3300044712 Ga0453684_0013005 Ga0453684_0013005_2988_3587 158
23 3300053136 Ga0500559_0010278 Ga0500559_0010278_586_1113 158
24 3300042876 Ga0451577_0636558 Ga0451577_0636558_184_783 162
25 3300044712 Ga0453684_0017394 Ga0453684_0017394_8379_8978 162
26 3300005467 Ga0070706_100589574 Ga0070706_1005895742 163
27 3300009147 Ga0114129_10221149 Ga0114129_102211491 163
28 3300009553 Ga0105249_10918679 Ga0105249_109186792 163
29 3300025910 Ga0207684_11004123 Ga0207684_110041231 163
30 iso_pu_bacteria 2842914999 2842918358 163
31 iso_pu_bacteria 2919085039 2919086992 163
32 iso_pu_bacteria 8002285264 8002289563 163
33 3300004799 Ga0058863_11734117 Ga0058863_117341172 164
34 3300004800 Ga0058861_11892879 Ga0058861_118928792 164
35 3300004803 Ga0058862_10112573 Ga0058862_101125732 164
36 3300005327 Ga0070658_10000519 Ga0070658_1000051925 164
37 3300005336 Ga0070680_100200220 Ga0070680_1002002202 164
38 3300005530 Ga0070679_100696975 Ga0070679_1006969752 164
39 3300005563 Ga0068855_100256897 Ga0068855_1002568972 164
40 3300009093 Ga0105240_10003040 Ga0105240_1000304020 164
41 3300009093 Ga0105240_10004382 Ga0105240_1000438212 164
42 3300014969 Ga0157376_10005919 Ga0157376_100059194 164
43 3300025909 Ga0207705_10016217 Ga0207705_100162176 164
44 3300025913 Ga0207695_10011071 Ga0207695_100110714 164
45 3300025913 Ga0207695_10016376 Ga0207695_1001637610 164
46 3300025917 Ga0207660_10175176 Ga0207660_101751763 164
47 3300025921 Ga0207652_10051877 Ga0207652_100518774 164
48 3300025921 Ga0207652_10634751 Ga0207652_106347512 164
49 3300044901 Ga0466960_0082359 Ga0466960_0082359_463_960 164
50 3300045836 Ga0466958_0148657 Ga0466958_0148657_753_1250 164
51 3300005467 Ga0070706_100014913 Ga0070706_1000149133 165
52 3300005468 Ga0070707_100132030 Ga0070707_1001320304 165
53 3300005471 Ga0070698_100080253 Ga0070698_1000802536 165
54 3300005518 Ga0070699_100224132 Ga0070699_1002241322 165
55 3300005536 Ga0070697_100029688 Ga0070697_1000296885 165
56 3300006038 Ga0075365_10031839 Ga0075365_100318395 165
57 3300009147 Ga0114129_11066493 Ga0114129_110664931 165
58 3300014326 Ga0157380_10517980 Ga0157380_105179802 165
59 3300025922 Ga0207646_10316667 Ga0207646_103166673 165
60 3300050492 nmdc:mga0yw44_395626_c1 nmdc:mga0yw44_395626_c1_119_658 165
61 iso_pu_bacteria 2965062239 2965066775 165
62 3300005331 Ga0070670_100024409 Ga0070670_1000244096 166
63 3300005842 Ga0068858_100765101 Ga0068858_1007651011 166
64 3300010375 Ga0105239_10304861 Ga0105239_103048612 166
65 3300013104 Ga0157370_10000484 Ga0157370_1000048420 166
66 3300013297 Ga0157378_10052127 Ga0157378_100521273 166
67 3300025939 Ga0207665_10468673 Ga0207665_104686732 166
68 3300031344 Ga0265316_10502118 Ga0265316_105021182 166
69 3300035725 Ga0373947_0598093 Ga0373947_0598093_143_646 166
70 3300039450 Ga0436363_0434313 Ga0436363_0434313_337_840 166
71 3300044656 Ga0466969_0002995 Ga0466969_0002995_2596_3120 166
72 3300046501 Ga0495607_0000008 Ga0495607_0000008_99968_100498 166
73 3300046517 Ga0495630_0383512 Ga0495630_0383512_429_932 166
74 3300048917 Ga0496114_0100498 Ga0496114_0100498_1709_2227 166
75 3300048917 Ga0496114_0231817 Ga0496114_0231817_170_688 166
76 3300048919 Ga0496116_0151381 Ga0496116_0151381_152_682 166
77 3300048926 Ga0496123_0010946 Ga0496123_0010946_1041_1571 166
78 3300049568 Ga0501031_0012427 Ga0501031_0012427_2277_2795 166
79 3300049569 Ga0501032_0005377 Ga0501032_0005377_2684_3202 166
80 3300049570 Ga0501033_0022033 Ga0501033_0022033_3237_3755 166
81 3300049571 Ga0501034_0025516 Ga0501034_0025516_2727_3245 166
82 3300049572 Ga0501036_0017209 Ga0501036_0017209_2359_2877 166
83 3300049574 Ga0501038_0000458 Ga0501038_0000458_32345_32863 166
84 3300049575 Ga0501039_0047888 Ga0501039_0047888_523_1041 166
85 3300049579 Ga0501043_0006193 Ga0501043_0006193_7434_7952 166
86 3300049580 Ga0501046_0008197 Ga0501046_0008197_2375_2893 166
87 3300049581 Ga0501047_0008294 Ga0501047_0008294_2747_3265 166
88 3300049582 Ga0501048_0029473 Ga0501048_0029473_592_1110 166
89 3300049589 Ga0501073_0004594 Ga0501073_0004594_3015_3533 166
90 3300049742 Ga0501080_0032762 Ga0501080_0032762_2649_3167 166
91 3300049822 Ga0501035_0018433 Ga0501035_0018433_1737_2255 166
92 3300049823 Ga0501044_0076536 Ga0501044_0076536_1826_2344 166
93 3300060346 Ga0587111_0076026 Ga0587111_0076026_212_739 166
94 3300061734 Ga0530510_0627371 Ga0530510_0627371_137_640 166
95 iso_pu_bacteria 2643221595 2643988051 166
96 iso_pu_bacteria 2881147464 2881150497 166
97 iso_pu_bacteria 2924762789 2924767809 166
98 3300005327 Ga0070658_10000096 Ga0070658_1000009646 167
99 3300006844 Ga0075428_100009880 Ga0075428_10000988010 167
100 3300006847 Ga0075431_100019275 Ga0075431_10001927511 167
101 3300025258 Ga0209129_1000835 Ga0209129_100083526 167
102 3300025297 Ga0209758_1029974 Ga0209758_10299742 167
103 3300025909 Ga0207705_10000141 Ga0207705_1000014146 167
104 3300003761 Ga0055535_1000123 Ga0055535_100012370 168
105 3300003763 Ga0055529_1000159 Ga0055529_100015914 168
106 3300025230 Ga0209563_108811 Ga0209563_1088112 168
107 3300025242 Ga0209258_100060 Ga0209258_10006069 168
108 3300025254 Ga0209148_1003371 Ga0209148_10033714 168
109 3300025256 Ga0209759_1000282 Ga0209759_100028266 168
110 3300025272 Ga0209455_1000136 Ga0209455_100013614 168
111 3300031239 Ga0265328_10011283 Ga0265328_100112836 168
112 3300031251 Ga0265327_10000499 Ga0265327_1000049910 168
113 3300031730 Ga0307516_10000442 Ga0307516_1000044236 168
114 3300035172 Ga0373955_0471487 Ga0373955_0471487_103_642 168
115 3300036401 Ga0373937_0435811 Ga0373937_0435811_260_799 168
116 3300046475 Ga0495639_0044096 Ga0495639_0044096_1224_1733 168
117 3300005563 Ga0068855_100000086 Ga0068855_10000008623 169
118 3300025949 Ga0207667_10000229 Ga0207667_100002291 169
119 3300031911 Ga0307412_10102143 Ga0307412_101021433 169
120 3300050492 nmdc:mga0yw44_143124_c1 nmdc:mga0yw44_143124_c1_884_1417 169
121 3300053079 Ga0500610_0015135 Ga0500610_0015135_1654_2187 169
122 3300053134 Ga0500658_0250030 Ga0500658_0250030_215_748 169
123 3300035118 Ga0373954_0128336 Ga0373954_0128336_476_1003 170
124 3300035172 Ga0373955_0031560 Ga0373955_0031560_1291_1818 170
125 3300035692 Ga0373935_0575330 Ga0373935_0575330_164_691 170
126 3300035724 Ga0373933_0015219 Ga0373933_0015219_1676_2203 170
127 3300035725 Ga0373947_0083237 Ga0373947_0083237_253_780 170
128 3300035725 Ga0373947_0098950 Ga0373947_0098950_491_1018 170
129 3300036401 Ga0373937_0010746 Ga0373937_0010746_5274_5801 170
130 3300037068 Ga0373925_0162604 Ga0373925_0162604_1122_1649 170
131 3300046462 Ga0495651_0003356 Ga0495651_0003356_1958_2485 170
132 3300046511 Ga0495608_0054941 Ga0495608_0054941_424_951 170
133 3300046516 Ga0495628_0296261 Ga0495628_0296261_72_599 170
134 3300046533 Ga0495640_0275840 Ga0495640_0275840_98_625 170
135 3300046536 Ga0495587_0204930 Ga0495587_0204930_469_996 170
136 3300046683 Ga0495658_0569639 Ga0495658_0569639_92_619 170
137 iso_pu_bacteria 2513237165 2514043604 170
138 3300005434 Ga0070709_10069656 Ga0070709_100696564 171
139 3300005436 Ga0070713_101070766 Ga0070713_1010707662 171
140 3300005536 Ga0070697_100467276 Ga0070697_1004672762 171
141 3300009093 Ga0105240_10000002 Ga0105240_10000002355 171
142 3300009093 Ga0105240_11069548 Ga0105240_110695482 171
143 3300025906 Ga0207699_10722182 Ga0207699_107221821 171
144 3300025913 Ga0207695_10000002 Ga0207695_10000002357 171
145 3300035116 Ga0373945_0032795 Ga0373945_0032795_404_979 171
146 3300035695 Ga0373927_0012460 Ga0373927_0012460_2214_2789 171
147 3300035725 Ga0373947_0014783 Ga0373947_0014783_2194_2769 171
148 3300037068 Ga0373925_0000163 Ga0373925_0000163_24806_25381 171
149 3300046531 Ga0495665_0419247 Ga0495665_0419247_74_649 171
150 3300048910 Ga0496107_0439794 Ga0496107_0439794_412_954 172
151 3300053088 Ga0500644_0004644 Ga0500644_0004644_1466_2008 172
152 3300053093 Ga0500651_0022663 Ga0500651_0022663_2110_2652 172
153 3300003323 rootH1_10066339 rootH1_100663396 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

18

74

0.99

Feature Viewer

pLDDT pTM Quality
59.91 0.42 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map