F216284

General Info

Members Datasets Scaffolds Average Seq Length
153 106 153 80

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_101151966|Ga0070713_1011519662
Length 87
Sequence MRKDGMFIAVEVDDQAAADTELARRLSEACPVDIFAQKAGGSLEIAEQNLDECVLCRLCLDAAESDPTHPDQPVKIIKLYDNGAVLA

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
67 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
70 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
71 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
72 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
73 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
74 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
77 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
84 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
85 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
86 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
87 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
88 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
89 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
90 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
91 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
92 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
93 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
94 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
97 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
98 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
99 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
102 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
103 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
104 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
105 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
106 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.58
Rhizosphere 91.5
Stem 0
Stem Tuber 0
Unclassified 3.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100901276 3300005339 Bacteria 746
2 Ga0070661_100294513 3300005344 Bacteria 1262
3 Ga0070668_101582357 3300005347 Bacteria 600
4 Ga0070671_101172018 3300005355 Bacteria 676
5 Ga0070674_100615204 3300005356 Bacteria 920
6 Ga0070674_101686750 3300005356 Bacteria 573
7 Ga0070659_100341956 3300005366 Bacteria 1254
8 Ga0070703_10058887 3300005406 Bacteria 1251
9 Ga0070709_10361047 3300005434 Bacteria 1076
10 Ga0070709_11452664 3300005434 Bacteria 556
11 Ga0070714_100749950 3300005435 Bacteria 944
12 Ga0070714_100947265 3300005435 Bacteria 837
13 Ga0070714_101870225 3300005435 Bacteria 586
14 Ga0070713_100304618 3300005436 Bacteria 1468
15 Ga0070713_100704860 3300005436 Bacteria 964
16 Ga0070713_101151966 3300005436 Bacteria 750
17 Ga0070713_101407872 3300005436 Bacteria 676
18 Ga0070710_10293728 3300005437 Bacteria 1058
19 Ga0070710_10590318 3300005437 Bacteria 772
20 Ga0070710_11026814 3300005437 Bacteria 602
21 Ga0070711_100049447 3300005439 Bacteria 2880
22 Ga0070711_100252244 3300005439 Bacteria 1385
23 Ga0070711_100303678 3300005439 Bacteria 1270
24 Ga0070711_100715783 3300005439 Bacteria 844
25 Ga0070711_100957681 3300005439 Unclassified 733
26 Ga0070705_100106266 3300005440 Bacteria 1784
27 Ga0070663_100792892 3300005455 Unclassified 812
28 Ga0070678_101968476 3300005456 Unclassified 552
29 Ga0070662_101434373 3300005457 Bacteria 595
30 Ga0068867_101154617 3300005459 Bacteria 709
31 Ga0068867_102338927 3300005459 Bacteria 508
32 Ga0070707_100789871 3300005468 Bacteria 913
33 Ga0070697_100263468 3300005536 Bacteria 1476
34 Ga0070697_100502768 3300005536 Bacteria 1060
35 Ga0070695_100507525 3300005545 Bacteria 934
36 Ga0070695_100762152 3300005545 Bacteria 773
37 Ga0070704_100233585 3300005549 Bacteria 1501
38 Ga0070664_100247393 3300005564 Bacteria 1602
39 Ga0070664_100735071 3300005564 Bacteria 921
40 Ga0068854_101273650 3300005578 Bacteria 661
41 Ga0068861_100524565 3300005719 Bacteria 1075
42 Ga0081539_10010069 3300005985 Bacteria 7768
43 Ga0070717_10314725 3300006028 Bacteria 1394
44 Ga0070717_11626945 3300006028 Bacteria 585
45 Ga0070716_100188082 3300006173 Bacteria 1362
46 Ga0070712_100011819 3300006175 Bacteria 5547
47 Ga0070712_100026266 3300006175 Bacteria 3877
48 Ga0070712_100297166 3300006175 Bacteria 1306
49 Ga0070712_100590100 3300006175 Bacteria 939
50 Ga0075434_100364410 3300006871 Bacteria 1466
51 Ga0075436_101349930 3300006914 Bacteria 540
52 Ga0075435_100445160 3300007076 Bacteria 1117
53 Ga0105245_11568068 3300009098 Bacteria 710
54 Ga0105245_12662194 3300009098 Bacteria 553
55 Ga0105243_10460128 3300009148 Bacteria 1196
56 Ga0105242_10972643 3300009176 Bacteria 854
57 Ga0105237_10008839 3300009545 Bacteria 10859
58 Ga0105237_12640598 3300009545 Bacteria 513
59 Ga0105249_10470195 3300009553 Bacteria 1299
60 Ga0105246_11844680 3300011119 Bacteria 579
61 Ga0157378_10827749 3300013297 Bacteria 953
62 Ga0157375_11047935 3300013308 Bacteria 953
63 Ga0157377_10518759 3300014745 Bacteria 836
64 Ga0213876_10216365 3300021384 Bacteria 1019
65 Ga0213875_10258545 3300021388 Bacteria 821
66 Ga0207699_10513700 3300025906 Bacteria 866
67 Ga0207699_11199918 3300025906 Bacteria 562
68 Ga0207671_10001682 3300025914 Bacteria 25096
69 Ga0207693_10027654 3300025915 Bacteria 4483
70 Ga0207693_10233147 3300025915 Bacteria 1446
71 Ga0207693_10245813 3300025915 Bacteria 1404
72 Ga0207693_10497260 3300025915 Bacteria 952
73 Ga0207693_10555383 3300025915 Bacteria 895
74 Ga0207663_10000560 3300025916 Bacteria 16421
75 Ga0207663_10230534 3300025916 Bacteria 1353
76 Ga0207660_11721328 3300025917 Bacteria 504
77 Ga0207646_10667798 3300025922 Bacteria 930
78 Ga0207650_11701353 3300025925 Bacteria 535
79 Ga0207687_10485593 3300025927 Bacteria 1029
80 Ga0207700_10318095 3300025928 Bacteria 1348
81 Ga0207700_11196495 3300025928 Bacteria 678
82 Ga0207700_11379141 3300025928 Bacteria 627
83 Ga0207664_10471259 3300025929 Bacteria 1122
84 Ga0207664_11433295 3300025929 Bacteria 612
85 Ga0207644_10960007 3300025931 Bacteria 717
86 Ga0207706_10117385 3300025933 Bacteria 2340
87 Ga0207709_10047945 3300025935 Bacteria 2600
88 Ga0207669_10612611 3300025937 Bacteria 886
89 Ga0207704_10939794 3300025938 Bacteria 729
90 Ga0207665_10414795 3300025939 Bacteria 1028
91 Ga0207665_10681748 3300025939 Unclassified 807
92 Ga0207679_10122489 3300025945 Bacteria 2073
93 Ga0207678_10922840 3300026067 Unclassified 772
94 Ga0207648_11461500 3300026089 Bacteria 642
95 Ga0207648_11471971 3300026089 Bacteria 640
96 Ga0207683_10831514 3300026121 Bacteria 857
97 Ga0207683_11613723 3300026121 Bacteria 598
98 Ga0265319_1082259 3300028563 Bacteria 1022
99 Ga0265338_10500382 3300028800 Bacteria 856
100 Ga0265316_10341457 3300031344 Bacteria 1085
101 Ga0373944_0217783 3300035089 Bacteria 696
102 Ga0373925_0377433 3300037068 Bacteria 1154
103 Ga0436365_0612889 3300039437 Bacteria 3085
104 Ga0436363_0835389 3300039450 Bacteria 587
105 Ga0436362_1290063 3300039453 Bacteria 587
106 Ga0451847_0019359 3300041503 Bacteria 685
107 Ga0466965_0084351 3300044683 Bacteria 1609
108 Ga0466966_0046021 3300044684 Bacteria 2788
109 Ga0466963_0023969 3300044694 Bacteria 3881
110 Ga0466963_0493739 3300044694 Unclassified 864
111 Ga0466963_0632123 3300044694 Bacteria 756
112 Ga0466971_0473737 3300044719 Bacteria 616
113 Ga0466968_0026564 3300044735 Bacteria 2377
114 Ga0466968_0371451 3300044735 Bacteria 697
115 Ga0466970_0104753 3300044765 Bacteria 1542
116 Ga0466970_0245259 3300044765 Bacteria 1003
117 Ga0466957_0009748 3300044842 Bacteria 5486
118 Ga0466957_0140777 3300044842 Bacteria 1554
119 Ga0466960_0010832 3300044901 Bacteria 3797
120 Ga0466959_0019667 3300045049 Bacteria 4967
121 Ga0466958_0151362 3300045836 Bacteria 1463
122 Ga0466967_0209427 3300045976 Bacteria 1849
123 Ga0466967_0363651 3300045976 Bacteria 1402
124 Ga0466967_0652846 3300045976 Bacteria 1040
125 Ga0495653_0000183 3300046463 Bacteria 51182
126 Ga0495580_0389844 3300046472 Bacteria 940
127 Ga0495618_0000054 3300046514 Bacteria 83787
128 Ga0495630_0093680 3300046517 Bacteria 2270
129 Ga0495645_0000354 3300046543 Bacteria 32418
130 Ga0495634_0187542 3300046642 Bacteria 1292
131 Ga0495588_0110203 3300046674 Bacteria 1450
132 Ga0495657_0000006 3300046675 Bacteria 250610
133 Ga0495646_0214205 3300046680 Bacteria 1044
134 Ga0495684_0002026 3300047471 Bacteria 16297
135 Ga0495684_0029960 3300047471 Bacteria 4178
136 Ga0495614_0111591 3300048089 Bacteria 1201
137 Ga0496100_0000874 3300048903 Bacteria 14382
138 Ga0496102_0191999 3300048905 Bacteria 1925
139 Ga0496102_0903720 3300048905 Bacteria 805
140 Ga0496102_1142620 3300048905 Bacteria 698
141 Ga0496103_0047147 3300048906 Bacteria 2662
142 Ga0496115_0000226 3300048918 Bacteria 51586
143 Ga0496115_0000298 3300048918 Bacteria 42677
144 Ga0496121_0001544 3300048924 Bacteria 38548
145 Ga0501036_0347167 3300049572 Bacteria 1239
146 Ga0501047_0056059 3300049581 Bacteria 3810
147 Ga0501067_0494989 3300049583 Bacteria 684
148 Ga0501076_0479771 3300049592 Bacteria 1025
149 nmdc:mga0n895_348604_c1 3300050512 Bacteria 1499
150 Ga0495601_0019677 3300053077 Bacteria 4119
151 Ga0495601_0808876 3300053077 Bacteria 595
152 Ga0495612_0000049 3300053078 Bacteria 54959
153 Ga0466962_0090832 3300061719 Bacteria 1463

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044901 Ga0466960_0010832 Ga0466960_0010832_1405_1650 64
2 3300005536 Ga0070697_100263468 Ga0070697_1002634682 65
3 3300005355 Ga0070671_101172018 Ga0070671_1011720182 74
4 3300005356 Ga0070674_101686750 Ga0070674_1016867502 74
5 3300005406 Ga0070703_10058887 Ga0070703_100588872 74
6 3300005440 Ga0070705_100106266 Ga0070705_1001062662 74
7 3300005459 Ga0068867_101154617 Ga0068867_1011546172 74
8 3300005545 Ga0070695_100507525 Ga0070695_1005075252 74
9 3300005549 Ga0070704_100233585 Ga0070704_1002335852 74
10 3300009098 Ga0105245_12662194 Ga0105245_126621942 74
11 3300009148 Ga0105243_10460128 Ga0105243_104601282 74
12 3300009176 Ga0105242_10972643 Ga0105242_109726432 74
13 3300009553 Ga0105249_10470195 Ga0105249_104701952 74
14 3300013297 Ga0157378_10827749 Ga0157378_108277492 74
15 3300013308 Ga0157375_11047935 Ga0157375_110479352 74
16 3300025927 Ga0207687_10485593 Ga0207687_104855932 74
17 3300025931 Ga0207644_10960007 Ga0207644_109600072 74
18 3300025935 Ga0207709_10047945 Ga0207709_100479453 74
19 3300048905 Ga0496102_0191999 Ga0496102_0191999_788_1024 74
20 3300005468 Ga0070707_100789871 Ga0070707_1007898711 75
21 3300025922 Ga0207646_10667798 Ga0207646_106677982 75
22 3300048905 Ga0496102_0903720 Ga0496102_0903720_253_492 75
23 3300005344 Ga0070661_100294513 Ga0070661_1002945132 76
24 3300005347 Ga0070668_101582357 Ga0070668_1015823572 76
25 3300005356 Ga0070674_100615204 Ga0070674_1006152042 76
26 3300005366 Ga0070659_100341956 Ga0070659_1003419563 76
27 3300005455 Ga0070663_100792892 Ga0070663_1007928922 76
28 3300005457 Ga0070662_101434373 Ga0070662_1014343732 76
29 3300005459 Ga0068867_102338927 Ga0068867_1023389271 76
30 3300005578 Ga0068854_101273650 Ga0068854_1012736502 76
31 3300005719 Ga0068861_100524565 Ga0068861_1005245652 76
32 3300006914 Ga0075436_101349930 Ga0075436_1013499302 76
33 3300009098 Ga0105245_11568068 Ga0105245_115680682 76
34 3300011119 Ga0105246_11844680 Ga0105246_118446802 76
35 3300014745 Ga0157377_10518759 Ga0157377_105187592 76
36 3300025933 Ga0207706_10117385 Ga0207706_101173854 76
37 3300025937 Ga0207669_10612611 Ga0207669_106126112 76
38 3300025938 Ga0207704_10939794 Ga0207704_109397942 76
39 3300026067 Ga0207678_10922840 Ga0207678_109228402 76
40 3300026089 Ga0207648_11471971 Ga0207648_114719712 76
41 3300026121 Ga0207683_10831514 Ga0207683_108315142 76
42 3300025925 Ga0207650_11701353 Ga0207650_117013532 77
43 3300049581 Ga0501047_0056059 Ga0501047_0056059_2799_3035 77
44 3300028800 Ga0265338_10500382 Ga0265338_105003822 78
45 3300044694 Ga0466963_0632123 Ga0466963_0632123_348_587 78
46 3300045976 Ga0466967_0209427 Ga0466967_0209427_452_691 78
47 3300005564 Ga0070664_100247393 Ga0070664_1002473932 79
48 3300005564 Ga0070664_100735071 Ga0070664_1007350712 79
49 3300005985 Ga0081539_10010069 Ga0081539_100100692 79
50 3300006175 Ga0070712_100590100 Ga0070712_1005901002 79
51 3300025915 Ga0207693_10555383 Ga0207693_105553832 79
52 3300025917 Ga0207660_11721328 Ga0207660_117213281 79
53 3300025945 Ga0207679_10122489 Ga0207679_101224893 79
54 3300028563 Ga0265319_1082259 Ga0265319_10822592 79
55 3300039450 Ga0436363_0835389 Ga0436363_0835389_133_375 79
56 3300044683 Ga0466965_0084351 Ga0466965_0084351_206_448 79
57 3300044684 Ga0466966_0046021 Ga0466966_0046021_788_1030 79
58 3300044694 Ga0466963_0023969 Ga0466963_0023969_3260_3502 79
59 3300044719 Ga0466971_0473737 Ga0466971_0473737_116_358 79
60 3300044735 Ga0466968_0371451 Ga0466968_0371451_156_398 79
61 3300044765 Ga0466970_0245259 Ga0466970_0245259_132_374 79
62 3300044842 Ga0466957_0009748 Ga0466957_0009748_4628_4870 79
63 3300044842 Ga0466957_0140777 Ga0466957_0140777_976_1218 79
64 3300045049 Ga0466959_0019667 Ga0466959_0019667_212_454 79
65 3300045836 Ga0466958_0151362 Ga0466958_0151362_622_864 79
66 3300045976 Ga0466967_0652846 Ga0466967_0652846_156_398 79
67 3300048903 Ga0496100_0000874 Ga0496100_0000874_12300_12542 79
68 3300048905 Ga0496102_1142620 Ga0496102_1142620_366_608 79
69 3300048906 Ga0496103_0047147 Ga0496103_0047147_2269_2511 79
70 3300048918 Ga0496115_0000226 Ga0496115_0000226_45083_45325 79
71 3300048924 Ga0496121_0001544 Ga0496121_0001544_10428_10670 79
72 3300049583 Ga0501067_0494989 Ga0501067_0494989_306_548 79
73 3300061719 Ga0466962_0090832 Ga0466962_0090832_727_969 79
74 3300005434 Ga0070709_10361047 Ga0070709_103610472 80
75 3300005434 Ga0070709_11452664 Ga0070709_114526641 80
76 3300005435 Ga0070714_100749950 Ga0070714_1007499501 80
77 3300005435 Ga0070714_100947265 Ga0070714_1009472651 80
78 3300005435 Ga0070714_101870225 Ga0070714_1018702252 80
79 3300005436 Ga0070713_100704860 Ga0070713_1007048602 80
80 3300005436 Ga0070713_101151966 Ga0070713_1011519662 80
81 3300005436 Ga0070713_101407872 Ga0070713_1014078721 80
82 3300005437 Ga0070710_10293728 Ga0070710_102937282 80
83 3300005437 Ga0070710_10590318 Ga0070710_105903181 80
84 3300005437 Ga0070710_11026814 Ga0070710_110268141 80
85 3300005439 Ga0070711_100049447 Ga0070711_1000494472 80
86 3300005439 Ga0070711_100252244 Ga0070711_1002522442 80
87 3300005439 Ga0070711_100303678 Ga0070711_1003036782 80
88 3300005439 Ga0070711_100715783 Ga0070711_1007157832 80
89 3300005439 Ga0070711_100957681 Ga0070711_1009576813 80
90 3300005456 Ga0070678_101968476 Ga0070678_1019684762 80
91 3300005536 Ga0070697_100502768 Ga0070697_1005027682 80
92 3300005545 Ga0070695_100762152 Ga0070695_1007621522 80
93 3300006028 Ga0070717_10314725 Ga0070717_103147252 80
94 3300006028 Ga0070717_11626945 Ga0070717_116269451 80
95 3300006173 Ga0070716_100188082 Ga0070716_1001880822 80
96 3300006175 Ga0070712_100011819 Ga0070712_1000118197 80
97 3300006175 Ga0070712_100026266 Ga0070712_1000262664 80
98 3300006175 Ga0070712_100297166 Ga0070712_1002971661 80
99 3300006871 Ga0075434_100364410 Ga0075434_1003644102 80
100 3300007076 Ga0075435_100445160 Ga0075435_1004451602 80
101 3300009545 Ga0105237_10008839 Ga0105237_100088395 80
102 3300009545 Ga0105237_12640598 Ga0105237_126405981 80
103 3300021384 Ga0213876_10216365 Ga0213876_102163652 80
104 3300025906 Ga0207699_10513700 Ga0207699_105137001 80
105 3300025906 Ga0207699_11199918 Ga0207699_111999182 80
106 3300025914 Ga0207671_10001682 Ga0207671_100016822 80
107 3300025915 Ga0207693_10027654 Ga0207693_100276547 80
108 3300025915 Ga0207693_10233147 Ga0207693_102331471 80
109 3300025915 Ga0207693_10245813 Ga0207693_102458134 80
110 3300025915 Ga0207693_10497260 Ga0207693_104972601 80
111 3300025916 Ga0207663_10000560 Ga0207663_1000056015 80
112 3300025916 Ga0207663_10230534 Ga0207663_102305342 80
113 3300025928 Ga0207700_11196495 Ga0207700_111964951 80
114 3300025928 Ga0207700_11379141 Ga0207700_113791412 80
115 3300025929 Ga0207664_10471259 Ga0207664_104712593 80
116 3300025929 Ga0207664_11433295 Ga0207664_114332952 80
117 3300025939 Ga0207665_10414795 Ga0207665_104147952 80
118 3300025939 Ga0207665_10681748 Ga0207665_106817481 80
119 3300026089 Ga0207648_11461500 Ga0207648_114615001 80
120 3300026121 Ga0207683_11613723 Ga0207683_116137232 80
121 3300031344 Ga0265316_10341457 Ga0265316_103414572 80
122 3300035089 Ga0373944_0217783 Ga0373944_0217783_312_557 80
123 3300037068 Ga0373925_0377433 Ga0373925_0377433_602_847 80
124 3300039437 Ga0436365_0612889 Ga0436365_0612889_2568_2816 80
125 3300044694 Ga0466963_0493739 Ga0466963_0493739_92_337 80
126 3300044735 Ga0466968_0026564 Ga0466968_0026564_38_298 80
127 3300044765 Ga0466970_0104753 Ga0466970_0104753_1254_1514 80
128 3300045976 Ga0466967_0363651 Ga0466967_0363651_682_927 80
129 3300046463 Ga0495653_0000183 Ga0495653_0000183_4295_4540 80
130 3300046472 Ga0495580_0389844 Ga0495580_0389844_485_730 80
131 3300046514 Ga0495618_0000054 Ga0495618_0000054_60541_60786 80
132 3300046517 Ga0495630_0093680 Ga0495630_0093680_1349_1594 80
133 3300046543 Ga0495645_0000354 Ga0495645_0000354_3761_4015 80
134 3300046642 Ga0495634_0187542 Ga0495634_0187542_777_1022 80
135 3300046674 Ga0495588_0110203 Ga0495588_0110203_770_1015 80
136 3300046675 Ga0495657_0000006 Ga0495657_0000006_190888_191133 80
137 3300046680 Ga0495646_0214205 Ga0495646_0214205_424_678 80
138 3300047471 Ga0495684_0002026 Ga0495684_0002026_6688_6933 80
139 3300047471 Ga0495684_0029960 Ga0495684_0029960_2326_2571 80
140 3300048089 Ga0495614_0111591 Ga0495614_0111591_559_804 80
141 3300048918 Ga0496115_0000298 Ga0496115_0000298_4977_5222 80
142 3300049572 Ga0501036_0347167 Ga0501036_0347167_716_961 80
143 3300049592 Ga0501076_0479771 Ga0501076_0479771_130_375 80
144 3300050512 nmdc:mga0n895_348604_c1 nmdc:mga0n895_348604_c1_339_584 80
145 3300053077 Ga0495601_0019677 Ga0495601_0019677_3519_3764 80
146 3300053077 Ga0495601_0808876 Ga0495601_0808876_185_439 80
147 3300053078 Ga0495612_0000049 Ga0495612_0000049_7297_7542 80
148 3300005436 Ga0070713_100304618 Ga0070713_1003046183 81
149 3300025928 Ga0207700_10318095 Ga0207700_103180952 81
150 3300021388 Ga0213875_10258545 Ga0213875_102585452 82
151 3300041503 Ga0451847_0019359 Ga0451847_0019359_100_366 82
152 3300039453 Ga0436362_1290063 Ga0436362_1290063_302_562 83
153 3300005339 Ga0070660_100901276 Ga0070660_1009012762 84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oq4-assembly1.cif.gz_D cryo-em structure of the atv rnap inhibitory protein (rip) bound to the dna-binding channel of the host's rna polymerase 0.7669 1 72
7ok0-assembly1.cif.gz_D cryo-em structure of the sulfolobus acidocaldarius rna polymerase at 2.88 a 0.7588 1 72
7oqy-assembly1.cif.gz_D cryo-em structure of the cellular negative regulator tfs4 bound to the archaeal rna polymerase 0.755 1 72
2y0s-assembly2.cif.gz_D crystal structure of sulfolobus shibatae rna polymerase in p21 space group 0.7499 1 72
7bkb-assembly1.cif.gz_L formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) 0.7341 8 69
ID Description Score Start End Superfamily
2y0sD03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.791 7 69 3.30.70.20
2y0sD03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7326 7 69 3.30.70.20
af_Q46905_5_80_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.725 1 67 3.30.70.20
af_A0A1D6PB11_1_97_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.717 4 72 3.30.70.20
af_Q8IHT3_226_284_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7146 3 63 3.30.70.20
ID Description Score Start End GO Terms
AF-A0A538L495-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.9885 5 80
AF-A0A5B8U4T3-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.9851 1 80
AF-A0A2T4UDQ8-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.9841 1 80
AF-A0A538KXF8-F1-model_v4 Ferredoxin family protein 0.984 1 81
AF-A0A7V8WAV0-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.9732 5 81

Feature Viewer

pLDDT pTM Quality
95.84 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map