F215396

General Info

Members Datasets Scaffolds Average Seq Length
152 49 304 149

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0028408|Ga0496121_0028408_1268_1732
Length 143
Sequence MSELKPFDDKLAGLIGALSPSGRRKLAGDIAKQLRRSQQQRIKQQTAPDGTPYQARRRQAMFQKLRTSRYMKVSGRNDTAVVEFTGKVQRIVQIHQYGLKDRPTPNSQDVQYPQRELLGFSRADKKYIDELVIDYLRNNSFLH

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
6 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
7 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
8 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
9 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
10 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
11 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
12 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
13 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
14 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
15 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
16 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
17 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
18 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
19 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
20 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
21 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
22 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
23 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
24 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
25 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
26 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
27 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
28 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
29 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
30 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
31 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
32 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
33 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
34 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
35 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
36 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
37 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
38 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
39 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
40 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
41 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
42 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
43 2751185917 Enterobacter sp. HK169 Isolate Unclassified
44 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
45 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
46 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
47 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
48 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
49 8018221730 Enterobacter sp. CM29 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.45
Metatranscriptomes 0
Isolates 8.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.97
Nodule 7.24
Rhizoplane 5.26
Rhizosphere 28.95
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0028408 3300048924 Bacteria 5206
2 SwRhRL2b_contig_610601 2162886007 Bacteria 1614
3 Ga0058692_1000270 3300003856 Bacteria 27729
4 Ga0065704_10088819 3300005289 Bacteria 2907
5 Ga0065704_10308755 3300005289 Bacteria 872
6 Ga0075364_10243700 3300006051 Bacteria 1221
7 Ga0079104_1001124 3300006946 Bacteria 19604
8 Ga0079104_1002056 3300006946 Bacteria 11665
9 Ga0079104_1002057 3300006946 Bacteria 11658
10 Ga0079104_1002387 3300006946 Bacteria 10239
11 Ga0079104_1002570 3300006946 Bacteria 9550
12 Ga0079104_1088799 3300006946 Bacteria 629
13 Ga0105251_10000780 3300009011 Bacteria 28924
14 Ga0105251_10004269 3300009011 Bacteria 9832
15 Ga0105251_10015271 3300009011 Bacteria 4205
16 Ga0105251_10019415 3300009011 Bacteria 3591
17 Ga0105251_10187690 3300009011 Viruses 931
18 Ga0105244_10000215 3300009036 Bacteria 59740
19 Ga0105244_10000821 3300009036 Bacteria 26251
20 Ga0105250_10003877 3300009092 Bacteria 7006
21 Ga0105250_10007674 3300009092 Bacteria 4623
22 Ga0105250_10009838 3300009092 Bacteria 4015
23 Ga0207696_1000282 3300025711 Bacteria 59781
24 Ga0207696_1003533 3300025711 Bacteria 7067
25 Ga0207696_1011918 3300025711 Bacteria 3102
26 Ga0207696_1013770 3300025711 Bacteria 2799
27 Ga0207655_1000065 3300025728 Bacteria 252767
28 Ga0207655_1000102 3300025728 Bacteria 185859
29 Ga0207713_1000640 3300025735 Bacteria 33797
30 Ga0207713_1001153 3300025735 Bacteria 22315
31 Ga0207713_1004045 3300025735 Bacteria 9684
32 Ga0209281_1000004 3300027111 Bacteria 1253949
33 Ga0209281_1000498 3300027111 Bacteria 53099
34 Ga0209281_1000707 3300027111 Bacteria 33791
35 Ga0209281_1001144 3300027111 Bacteria 18652
36 Ga0209281_1001221 3300027111 Bacteria 17230
37 Ga0209371_1000143 3300027312 Bacteria 117814
38 Ga0209371_1029085 3300027312 Bacteria 1225
39 Ga0268256_1000113 3300030500 Bacteria 117659
40 Ga0268256_1013352 3300030500 Bacteria 2493
41 Ga0268256_1033071 3300030500 Bacteria 1225
42 Ga0439432_000064 3300042006 Bacteria 32779
43 Ga0439432_002281 3300042006 Bacteria 7227
44 Ga0439452_004523 3300042010 Bacteria 4651
45 Ga0495627_176761 3300046453 Bacteria 592
46 Ga0495591_000284 3300046458 Bacteria 47332
47 Ga0495638_0003579 3300046460 Viruses 12167
48 Ga0495620_0000975 3300046515 Bacteria 17628
49 Ga0495588_0004863 3300046674 Bacteria 5950
50 Ga0495649_0126277 3300046694 Bacteria 1351
51 Ga0495679_016344 3300047446 Viruses 2687
52 Ga0495679_116620 3300047446 Viruses 732
53 Ga0496104_0211020 3300048907 Bacteria 1853
54 Ga0496104_0748731 3300048907 Bacteria 884
55 Ga0496105_0305964 3300048908 Bacteria 1277
56 Ga0496116_0000964 3300048919 Bacteria 35524
57 Ga0496116_0010082 3300048919 Bacteria 7966
58 Ga0496116_0010462 3300048919 Bacteria 7769
59 Ga0496116_0015883 3300048919 Bacteria 5924
60 Ga0496116_0034730 3300048919 Bacteria 3551
61 Ga0496116_0167370 3300048919 Bacteria 1196
62 Ga0496116_0291919 3300048919 Bacteria 782
63 Ga0496117_0001102 3300048920 Bacteria 40740
64 Ga0496117_0001231 3300048920 Bacteria 38343
65 Ga0496117_0001457 3300048920 Bacteria 34106
66 Ga0496117_0001550 3300048920 Bacteria 32632
67 Ga0496117_0004935 3300048920 Bacteria 14331
68 Ga0496117_0011742 3300048920 Bacteria 7809
69 Ga0496117_0027711 3300048920 Bacteria 4405
70 Ga0496117_0044454 3300048920 Bacteria 3217
71 Ga0496117_0062927 3300048920 Bacteria 2539
72 Ga0496117_0070102 3300048920 Bacteria 2357
73 Ga0496118_0000157 3300048921 Bacteria 121411
74 Ga0496118_0001622 3300048921 Bacteria 33213
75 Ga0496118_0001913 3300048921 Bacteria 29615
76 Ga0496118_0005926 3300048921 Bacteria 13669
77 Ga0496118_0009009 3300048921 Bacteria 10178
78 Ga0496118_0010696 3300048921 Bacteria 9046
79 Ga0496118_0017551 3300048921 Bacteria 6506
80 Ga0496118_0021311 3300048921 Bacteria 5709
81 Ga0496118_0050126 3300048921 Bacteria 3207
82 Ga0496118_0251138 3300048921 Bacteria 1005
83 Ga0496119_0001152 3300048922 Bacteria 33163
84 Ga0496119_0002104 3300048922 Bacteria 22453
85 Ga0496119_0007670 3300048922 Bacteria 9662
86 Ga0496119_0016384 3300048922 Viruses 5642
87 Ga0496119_0022760 3300048922 Bacteria 4473
88 Ga0496119_0024509 3300048922 Bacteria 4242
89 Ga0496119_0026189 3300048922 Bacteria 4049
90 Ga0496119_0087646 3300048922 Bacteria 1776
91 Ga0496119_0141754 3300048922 Bacteria 1297
92 Ga0496120_0001112 3300048923 Bacteria 34967
93 Ga0496120_0001186 3300048923 Bacteria 33163
94 Ga0496120_0016049 3300048923 Bacteria 4909
95 Ga0496120_0016839 3300048923 Bacteria 4760
96 Ga0496120_0019399 3300048923 Bacteria 4351
97 Ga0496120_0022555 3300048923 Bacteria 3958
98 Ga0496121_0000966 3300048924 Bacteria 51632
99 Ga0496121_0001746 3300048924 Bacteria 35496
100 Ga0496121_0001898 3300048924 Bacteria 33488
101 Ga0496121_0002058 3300048924 Bacteria 31836
102 Ga0496121_0002267 3300048924 Bacteria 29935
103 Ga0496121_0148934 3300048924 Bacteria 1725
104 Ga0496121_0232887 3300048924 Viruses 1289
105 Ga0496122_0000007 3300048925 Bacteria 606493
106 Ga0496122_0008333 3300048925 Bacteria 11214
107 Ga0496122_0037185 3300048925 Viruses 3923
108 Ga0496122_0042641 3300048925 Bacteria 3566
109 Ga0496122_0044705 3300048925 Bacteria 3452
110 Ga0496122_0071631 3300048925 Viruses 2469
111 Ga0496122_0288098 3300048925 Bacteria 893
112 Ga0496123_0000004 3300048926 Bacteria 777230
113 Ga0496123_0007634 3300048926 Bacteria 10122
114 Ga0496123_0127845 3300048926 Bacteria 1414
115 Ga0496123_0143158 3300048926 Viruses 1303
116 Ga0496123_0230443 3300048926 Bacteria 927
117 Ga0496124_0008680 3300048927 Bacteria 10570
118 Ga0496124_0008787 3300048927 Bacteria 10492
119 Ga0496124_0016771 3300048927 Bacteria 6945
120 Ga0496124_0018924 3300048927 Viruses 6429
121 Ga0496124_0019139 3300048927 Bacteria 6388
122 Ga0496124_0035755 3300048927 Bacteria 4342
123 Ga0496124_0065929 3300048927 Bacteria 3017
124 Ga0496124_0130061 3300048927 Bacteria 2001
125 Ga0496124_0636128 3300048927 Bacteria 687
126 Ga0496125_0000817 3300048928 Bacteria 50621
127 Ga0496125_0001863 3300048928 Bacteria 29003
128 Ga0496125_0010135 3300048928 Viruses 9557
129 Ga0496125_0035303 3300048928 Bacteria 4389
130 Ga0496126_0000825 3300048929 Bacteria 55137
131 Ga0496126_0002237 3300048929 Bacteria 26749
132 Ga0496126_0004011 3300048929 Bacteria 17941
133 Ga0496126_0007941 3300048929 Bacteria 11535
134 Ga0496126_0049664 3300048929 Bacteria 3828
135 Ga0496126_0053818 3300048929 Bacteria 3649
136 Ga0496126_0067826 3300048929 Bacteria 3186
137 Ga0496126_0186060 3300048929 Bacteria 1761
138 nmdc:mga00v17_4478_c1 3300050491 Bacteria 7270
139 nmdc:mga00v17_728126_c1 3300050491 Bacteria 635
140 2601536548 2600255256 Bacteria 5597742
141 2601541971 2600255257 Bacteria 5597196
142 2601760280 2600255310 Bacteria 5600903
143 2601765682 2600255311 Bacteria 5598766
144 2682005518 2681812869 Bacteria 5014465
145 2753856335 2751185917 Bacteria 4551186
146 2793404019 2791355275 Bacteria 4429597
147 2814698983 2814123068 Bacteria 5687681
148 2891674829 2891670763 Bacteria 4967099
149 2939571402 2939568625 Bacteria 4542555
150 2939572682 2939568625 Bacteria 4542555
151 3000379521 3000376612 Bacteria 4705565
152 8018223258 8018221730 Bacteria 4616064
153 Ga0496121_0028408
154 SwRhRL2b_contig_610601
155 Ga0058692_1000270
156 Ga0065704_10088819
157 Ga0065704_10308755
158 Ga0075364_10243700
159 Ga0079104_1001124
160 Ga0079104_1002056
161 Ga0079104_1002057
162 Ga0079104_1002387
163 Ga0079104_1002570
164 Ga0079104_1088799
165 Ga0105251_10000780
166 Ga0105251_10004269
167 Ga0105251_10015271
168 Ga0105251_10019415
169 Ga0105251_10187690
170 Ga0105244_10000215
171 Ga0105244_10000821
172 Ga0105250_10003877
173 Ga0105250_10007674
174 Ga0105250_10009838
175 Ga0207696_1000282
176 Ga0207696_1003533
177 Ga0207696_1011918
178 Ga0207696_1013770
179 Ga0207655_1000065
180 Ga0207655_1000102
181 Ga0207713_1000640
182 Ga0207713_1001153
183 Ga0207713_1004045
184 Ga0209281_1000004
185 Ga0209281_1000498
186 Ga0209281_1000707
187 Ga0209281_1001144
188 Ga0209281_1001221
189 Ga0209371_1000143
190 Ga0209371_1029085
191 Ga0268256_1000113
192 Ga0268256_1013352
193 Ga0268256_1033071
194 Ga0439432_000064
195 Ga0439432_002281
196 Ga0439452_004523
197 Ga0495627_176761
198 Ga0495591_000284
199 Ga0495638_0003579
200 Ga0495620_0000975
201 Ga0495588_0004863
202 Ga0495649_0126277
203 Ga0495679_016344
204 Ga0495679_116620
205 Ga0496104_0211020
206 Ga0496104_0748731
207 Ga0496105_0305964
208 Ga0496116_0000964
209 Ga0496116_0010082
210 Ga0496116_0010462
211 Ga0496116_0015883
212 Ga0496116_0034730
213 Ga0496116_0167370
214 Ga0496116_0291919
215 Ga0496117_0001102
216 Ga0496117_0001231
217 Ga0496117_0001457
218 Ga0496117_0001550
219 Ga0496117_0004935
220 Ga0496117_0011742
221 Ga0496117_0027711
222 Ga0496117_0044454
223 Ga0496117_0062927
224 Ga0496117_0070102
225 Ga0496118_0000157
226 Ga0496118_0001622
227 Ga0496118_0001913
228 Ga0496118_0005926
229 Ga0496118_0009009
230 Ga0496118_0010696
231 Ga0496118_0017551
232 Ga0496118_0021311
233 Ga0496118_0050126
234 Ga0496118_0251138
235 Ga0496119_0001152
236 Ga0496119_0002104
237 Ga0496119_0007670
238 Ga0496119_0016384
239 Ga0496119_0022760
240 Ga0496119_0024509
241 Ga0496119_0026189
242 Ga0496119_0087646
243 Ga0496119_0141754
244 Ga0496120_0001112
245 Ga0496120_0001186
246 Ga0496120_0016049
247 Ga0496120_0016839
248 Ga0496120_0019399
249 Ga0496120_0022555
250 Ga0496121_0000966
251 Ga0496121_0001746
252 Ga0496121_0001898
253 Ga0496121_0002058
254 Ga0496121_0002267
255 Ga0496121_0148934
256 Ga0496121_0232887
257 Ga0496122_0000007
258 Ga0496122_0008333
259 Ga0496122_0037185
260 Ga0496122_0042641
261 Ga0496122_0044705
262 Ga0496122_0071631
263 Ga0496122_0288098
264 Ga0496123_0000004
265 Ga0496123_0007634
266 Ga0496123_0127845
267 Ga0496123_0143158
268 Ga0496123_0230443
269 Ga0496124_0008680
270 Ga0496124_0008787
271 Ga0496124_0016771
272 Ga0496124_0018924
273 Ga0496124_0019139
274 Ga0496124_0035755
275 Ga0496124_0065929
276 Ga0496124_0130061
277 Ga0496124_0636128
278 Ga0496125_0000817
279 Ga0496125_0001863
280 Ga0496125_0010135
281 Ga0496125_0035303
282 Ga0496126_0000825
283 Ga0496126_0002237
284 Ga0496126_0004011
285 Ga0496126_0007941
286 Ga0496126_0049664
287 Ga0496126_0053818
288 Ga0496126_0067826
289 Ga0496126_0186060
290 nmdc:mga00v17_4478_c1
291 nmdc:mga00v17_728126_c1
292 2601536548
293 2601541971
294 2601760280
295 2601765682
296 2682005518
297 2753856335
298 2793404019
299 2814698983
300 2891674829
301 2939571402
302 2939572682
303 3000379521
304 8018223258

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05069

Phage_tail_S

Phage virion morphogenesis family

2

137

0.93

Map