F215328

General Info

Members Datasets Scaffolds Average Seq Length
152 119 70 158

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0228219|Ga0496100_0228219_353_889
Length 178
Sequence VKNTSHLINLKKRKVLNMADYTLEEKDSFTVLGFGTELKSDYTDFAGINKEKSDFWQAFSQDGRLDALKAIATNDYVFAVNEAVNNKMMHYAGVMTELSAPAPEEARIIQFPKGEYLVVKGEGRTADELNNKLAGIAFGQVLPEAKNFAYVGGPNTTVEMGQRNGLVFGEMWIPVVRK

Samples

Sample ID Description Type Environment
1 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
2 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
3 2554235283 Bacillus safensis VK Isolate Rhizosphere
4 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
5 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
6 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
7 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
8 2643221729 Bacillus sp. Root11 Isolate Unclassified
9 2643221730 Bacillus sp. Root131 Isolate Unclassified
10 2643221735 Bacillus sp. Root920 Isolate Unclassified
11 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
12 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
13 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
14 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
15 2738541295 Bacillus sp. OK085 Isolate Unclassified
16 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
17 2738541358 Bacillus sp. OV752 Isolate Unclassified
18 2738543006 Bacillus sp. OK077 Isolate Unclassified
19 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
20 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
21 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
22 2818991441 Niallia circulans 3243 Isolate Rhizosphere
23 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
24 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
25 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
26 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
27 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
28 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
29 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
30 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
31 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
32 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
33 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
34 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
35 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
36 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
37 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
38 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
39 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
40 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
41 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
42 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
43 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
44 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
45 2938917290 Bacillus sp. CR71 Isolate Unclassified
46 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
47 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
48 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
49 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
50 2965761152 Bacillus sp. COPE52 Isolate Unclassified
51 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
52 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
53 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
54 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
55 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
56 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
57 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
58 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
59 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
60 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
61 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
62 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
63 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
64 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
65 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
66 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
67 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
68 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
69 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
70 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
71 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
84 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
85 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
91 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
92 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
93 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
94 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
95 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
96 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
97 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
100 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
101 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
102 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
103 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
104 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
105 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
106 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
107 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
108 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
109 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified
110 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
111 8023438354 Bacillus sp. BH2 Isolate Unclassified
112 8023444577 Bacillus sp. BH32 Isolate Unclassified
113 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
114 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
115 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
116 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
117 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
118 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
119 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 46.05
Metatranscriptomes 0
Isolates 53.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.42
Nodule 0.66
Rhizoplane 3.29
Rhizosphere 44.08
Stem 0
Stem Tuber 0
Unclassified 33.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000012 3300003187 Bacteria 254028
2 JGI25151J46595_10006765 3300003187 Bacteria 5708
3 JGI25151J46595_10039733 3300003187 Bacteria 1733
4 JGI25151J46595_10046023 3300003187 Bacteria 1533
5 Ga0055538_1000191 3300003751 Bacteria 37242
6 Ga0055538_1000708 3300003751 Bacteria 10129
7 Ga0055532_1000004 3300003758 Bacteria 471824
8 Ga0055532_1002054 3300003758 Bacteria 4611
9 Ga0055541_1006736 3300003841 Bacteria 1928
10 Ga0065704_10235033 3300005289 Bacteria 1032
11 Ga0105244_10008936 3300009036 Bacteria 6204
12 Ga0105244_10030195 3300009036 Bacteria 2885
13 Ga0105244_10095973 3300009036 Bacteria 1455
14 Ga0105244_10207474 3300009036 Bacteria 922
15 Ga0105250_10010673 3300009092 Bacteria 3826
16 Ga0105250_10014279 3300009092 Bacteria 3267
17 Ga0209784_100140 3300025224 Bacteria 67518
18 Ga0209784_100645 3300025224 Bacteria 10459
19 Ga0209566_100024 3300025225 Bacteria 396318
20 Ga0209566_105290 3300025225 Bacteria 1642
21 Ga0209566_111151 3300025225 Bacteria 887
22 Ga0209147_100010 3300025229 Bacteria 741391
23 Ga0209147_100029 3300025229 Bacteria 376498
24 Ga0209147_112544 3300025229 Bacteria 906
25 Ga0209130_1000330 3300025284 Bacteria 54419
26 Ga0209130_1003253 3300025284 Bacteria 7118
27 Ga0209676_1112730 3300025292 Bacteria 559
28 Ga0209025_1000001 3300025294 Bacteria 1888151
29 Ga0209025_1000928 3300025294 Bacteria 44801
30 Ga0209025_1008247 3300025294 Bacteria 7530
31 Ga0209025_1019976 3300025294 Bacteria 3691
32 Ga0209025_1025545 3300025294 Bacteria 3001
33 Ga0209025_1035080 3300025294 Bacteria 2273
34 Ga0209025_1044621 3300025294 Bacteria 1849
35 Ga0209256_1056670 3300025299 Bacteria 926
36 Ga0207696_1003353 3300025711 Bacteria 7356
37 Ga0207655_1000987 3300025728 Bacteria 29054
38 Ga0207655_1178165 3300025728 Bacteria 651
39 Ga0207713_1081298 3300025735 Bacteria 1165
40 Ga0209371_1019309 3300027312 Bacteria 1704
41 Ga0237817_10008 3300030083 Bacteria 80875
42 Ga0237817_10578 3300030083 Bacteria 4014
43 Ga0237817_10607 3300030083 Bacteria 3679
44 Ga0268256_1021661 3300030500 Bacteria 1704
45 Ga0307408_100837338 3300031548 Bacteria 838
46 Ga0307409_100421720 3300031995 Bacteria 1280
47 Ga0373927_0814112 3300035695 Bacteria 617
48 Ga0395899_0154231 3300037312 Bacteria 1626
49 Ga0395899_0254395 3300037312 Bacteria 1204
50 Ga0237819_01094 3300038705 Bacteria 7971
51 Ga0466967_0000200 3300045976 Bacteria 25062
52 Ga0466967_0879099 3300045976 Bacteria 891
53 Ga0495627_166719 3300046453 Bacteria 612
54 Ga0495637_0099265 3300046520 Bacteria 1140
55 Ga0495654_0166835 3300046530 Bacteria 963
56 Ga0495661_0195926 3300046665 Bacteria 1061
57 Ga0495670_0137590 3300046691 Bacteria 1276
58 Ga0495660_0043904 3300046810 Bacteria 2462
59 Ga0496100_0228219 3300048903 Bacteria 1369
60 Ga0496112_0132307 3300048915 Bacteria 2465
61 Ga0496113_0703698 3300048916 Bacteria 806
62 Ga0496115_0243575 3300048918 Bacteria 1482
63 Ga0496116_0017538 3300048919 Bacteria 5550
64 Ga0496116_0051057 3300048919 Bacteria 2750
65 Ga0496122_0037314 3300048925 Bacteria 3913
66 Ga0496123_0008916 3300048926 Bacteria 9118
67 Ga0496124_0000456 3300048927 Bacteria 71405
68 Ga0496125_0000188 3300048928 Bacteria 134959
69 Ga0496125_0160614 3300048928 Bacteria 1527
70 Ga0496125_0430483 3300048928 Bacteria 762

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 3006826541 3006827413 144
2 3300031995 Ga0307409_100421720 Ga0307409_1004217202 145
3 iso_pu_bacteria 2548877040 2550902424 155
4 iso_pu_bacteria 2554235283 2555470354 155
5 iso_pu_bacteria 2563366752 2563929355 155
6 iso_pu_bacteria 2571042143 2571528742 155
7 iso_pu_bacteria 2593339198 2595319311 155
8 iso_pu_bacteria 2600255286 2601637946 155
9 iso_pu_bacteria 2643221735 2644740165 155
10 iso_pu_bacteria 2728368933 2728535021 155
11 iso_pu_bacteria 2738541358 2739159345 155
12 iso_pu_bacteria 2738543006 2739212005 155
13 iso_pu_bacteria 2775507192 2777839952 155
14 iso_pu_bacteria 2791355222 2793183158 155
15 iso_pu_bacteria 2816332295 2817482359 155
16 iso_pu_bacteria 2818991441 2819569032 155
17 iso_pu_bacteria 2818991468 2819724964 155
18 iso_pu_bacteria 2821111986 2821112665 155
19 iso_pu_bacteria 2857453340 2857458715 155
20 iso_pu_bacteria 2864733723 2864736397 155
21 iso_pu_bacteria 2865002811 2865005064 155
22 iso_pu_bacteria 2865002811 2865005066 155
23 iso_pu_bacteria 2881644220 2881648893 155
24 iso_pu_bacteria 2885526491 2885531453 155
25 iso_pu_bacteria 2889042446 2889045721 155
26 iso_pu_bacteria 2897109615 2897113715 155
27 iso_pu_bacteria 2904162308 2904164031 155
28 iso_pu_bacteria 2904490793 2904492585 155
29 iso_pu_bacteria 2907202186 2907202876 155
30 iso_pu_bacteria 2908665501 2908665544 155
31 iso_pu_bacteria 2919093281 2919094354 155
32 iso_pu_bacteria 2919160200 2919161816 155
33 iso_pu_bacteria 2919414237 2919416913 155
34 iso_pu_bacteria 2931384279 2931389157 155
35 iso_pu_bacteria 2936361878 2936363478 155
36 iso_pu_bacteria 2938649242 2938655552 155
37 iso_pu_bacteria 2938917290 2938921242 155
38 iso_pu_bacteria 2945991243 2945992275 155
39 iso_pu_bacteria 2946053406 2946055026 155
40 iso_pu_bacteria 2954773129 2954774297 155
41 iso_pu_bacteria 2968558590 2968565001 155
42 iso_pu_bacteria 2971403814 2971406241 155
43 iso_pu_bacteria 2971410472 2971414841 155
44 iso_pu_bacteria 2977254563 2977259388 155
45 iso_pu_bacteria 2988225383 2988231379 155
46 iso_pu_bacteria 2990275345 2990280416 155
47 iso_pu_bacteria 2996632988 2996633460 155
48 iso_pu_bacteria 3001892409 3001896002 155
49 iso_pu_bacteria 3001892409 3001896305 155
50 iso_pu_bacteria 3006973921 3006975312 155
51 iso_pu_bacteria 3006973921 3006977859 155
52 iso_pu_bacteria 3006978542 3006982973 155
53 iso_pu_bacteria 3006984091 3006985162 155
54 iso_pu_bacteria 3006988479 3006990304 155
55 iso_pu_bacteria 8002317523 8002319538 155
56 iso_pu_bacteria 8007371054 8007372723 155
57 iso_pu_bacteria 8007375930 8007377217 155
58 iso_pu_bacteria 8023438354 8023440183 155
59 iso_pu_bacteria 8023444577 8023447056 155
60 iso_pu_bacteria 8046991243 8046996375 155
61 iso_pu_bacteria 8054280661 8054283133 155
62 iso_pu_bacteria 8054465665 8054468636 155
63 iso_pu_bacteria 8054795415 8054795663 155
64 iso_pu_bacteria 8056533031 8056539424 155
65 iso_pu_bacteria 8056533031 8056539426 155
66 iso_pu_bacteria 8057632132 8057636887 155
67 3300037312 Ga0395899_0254395 Ga0395899_0254395_459_932 157
68 iso_pu_bacteria 2551306519 2553391973 157
69 iso_pu_bacteria 2643221729 2644701661 157
70 iso_pu_bacteria 2643221730 2644710578 157
71 iso_pu_bacteria 2695420987 2698321858 157
72 iso_pu_bacteria 2703719227 2705995316 157
73 iso_pu_bacteria 2718218445 2721506569 157
74 iso_pu_bacteria 2738541295 2738816266 157
75 iso_pu_bacteria 2738541299 2738840493 157
76 iso_pu_bacteria 2818991443 2819580419 157
77 iso_pu_bacteria 2929233124 2929237082 157
78 iso_pu_bacteria 2947426588 2947430112 157
79 iso_pu_bacteria 2965761152 2965764683 157
80 iso_pu_bacteria 2979083700 2979087015 157
81 iso_pu_bacteria 3001272096 3001275514 157
82 iso_pu_bacteria 8022621104 8022623182 157
83 iso_pu_bacteria 8051952484 8051953803 157
84 3300003187 JGI25151J46595_10000012 JGI25151J46595_100000125 159
85 3300003187 JGI25151J46595_10006765 JGI25151J46595_100067653 159
86 3300003187 JGI25151J46595_10039733 JGI25151J46595_100397332 159
87 3300003187 JGI25151J46595_10046023 JGI25151J46595_100460231 159
88 3300003751 Ga0055538_1000191 Ga0055538_100019119 159
89 3300003751 Ga0055538_1000708 Ga0055538_10007084 159
90 3300003758 Ga0055532_1000004 Ga0055532_1000004432 159
91 3300003758 Ga0055532_1002054 Ga0055532_10020543 159
92 3300003841 Ga0055541_1006736 Ga0055541_10067363 159
93 3300005289 Ga0065704_10235033 Ga0065704_102350332 159
94 3300009036 Ga0105244_10008936 Ga0105244_100089364 159
95 3300009036 Ga0105244_10030195 Ga0105244_100301952 159
96 3300009036 Ga0105244_10095973 Ga0105244_100959731 159
97 3300009036 Ga0105244_10207474 Ga0105244_102074742 159
98 3300009092 Ga0105250_10010673 Ga0105250_100106734 159
99 3300009092 Ga0105250_10014279 Ga0105250_100142792 159
100 3300025224 Ga0209784_100140 Ga0209784_10014028 159
101 3300025224 Ga0209784_100645 Ga0209784_1006458 159
102 3300025225 Ga0209566_100024 Ga0209566_100024179 159
103 3300025225 Ga0209566_105290 Ga0209566_1052903 159
104 3300025225 Ga0209566_111151 Ga0209566_1111512 159
105 3300025229 Ga0209147_100010 Ga0209147_10001069 159
106 3300025229 Ga0209147_100029 Ga0209147_100029332 159
107 3300025229 Ga0209147_112544 Ga0209147_1125441 159
108 3300025284 Ga0209130_1000330 Ga0209130_100033059 159
109 3300025284 Ga0209130_1003253 Ga0209130_10032534 159
110 3300025292 Ga0209676_1112730 Ga0209676_11127301 159
111 3300025294 Ga0209025_1000001 Ga0209025_10000011073 159
112 3300025294 Ga0209025_1000928 Ga0209025_10009285 159
113 3300025294 Ga0209025_1008247 Ga0209025_10082477 159
114 3300025294 Ga0209025_1019976 Ga0209025_10199765 159
115 3300025294 Ga0209025_1025545 Ga0209025_10255452 159
116 3300025294 Ga0209025_1035080 Ga0209025_10350805 159
117 3300025294 Ga0209025_1044621 Ga0209025_10446212 159
118 3300025299 Ga0209256_1056670 Ga0209256_10566701 159
119 3300025711 Ga0207696_1003353 Ga0207696_10033534 159
120 3300025728 Ga0207655_1000987 Ga0207655_100098725 159
121 3300025728 Ga0207655_1178165 Ga0207655_11781651 159
122 3300025735 Ga0207713_1081298 Ga0207713_10812981 159
123 3300027312 Ga0209371_1019309 Ga0209371_10193091 159
124 3300030083 Ga0237817_10008 Ga0237817_1000867 159
125 3300030083 Ga0237817_10578 Ga0237817_105782 159
126 3300030083 Ga0237817_10607 Ga0237817_106075 159
127 3300030500 Ga0268256_1021661 Ga0268256_10216611 159
128 3300031548 Ga0307408_100837338 Ga0307408_1008373382 159
129 3300035695 Ga0373927_0814112 Ga0373927_0814112_35_514 159
130 3300037312 Ga0395899_0154231 Ga0395899_0154231_1013_1492 159
131 3300038705 Ga0237819_01094 Ga0237819_01094_1417_1896 159
132 3300045976 Ga0466967_0000200 Ga0466967_0000200_16036_16515 159
133 3300045976 Ga0466967_0879099 Ga0466967_0879099_346_831 159
134 3300046453 Ga0495627_166719 Ga0495627_166719_103_582 159
135 3300046520 Ga0495637_0099265 Ga0495637_0099265_642_1121 159
136 3300046530 Ga0495654_0166835 Ga0495654_0166835_248_778 159
137 3300046665 Ga0495661_0195926 Ga0495661_0195926_52_531 159
138 3300046691 Ga0495670_0137590 Ga0495670_0137590_185_730 159
139 3300046810 Ga0495660_0043904 Ga0495660_0043904_1114_1593 159
140 3300048903 Ga0496100_0228219 Ga0496100_0228219_353_889 159
141 3300048915 Ga0496112_0132307 Ga0496112_0132307_722_1240 159
142 3300048916 Ga0496113_0703698 Ga0496113_0703698_195_731 159
143 3300048918 Ga0496115_0243575 Ga0496115_0243575_915_1445 159
144 3300048919 Ga0496116_0017538 Ga0496116_0017538_2477_2956 159
145 3300048919 Ga0496116_0051057 Ga0496116_0051057_1932_2462 159
146 3300048925 Ga0496122_0037314 Ga0496122_0037314_565_1044 159
147 3300048926 Ga0496123_0008916 Ga0496123_0008916_5251_5730 159
148 3300048927 Ga0496124_0000456 Ga0496124_0000456_31240_31719 159
149 3300048928 Ga0496125_0000188 Ga0496125_0000188_84670_85149 159
150 3300048928 Ga0496125_0160614 Ga0496125_0160614_485_964 159
151 3300048928 Ga0496125_0430483 Ga0496125_0430483_17_502 159
152 iso_pu_bacteria 2904113452 2904116345 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14526

Cass2

Integron-associated effector binding protein

22

175

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kat-assembly1.cif.gz_A the structure of sav2435 bound to tetraphenylphosphonium 0.774 3 157
3lur-assembly3.cif.gz_C crystal structure of putative bacterial transcription regulation protein (np_372959.1) from staphylococcus aureus mu50 at 1.81 a resolution 0.7681 1 156
3lur-assembly3.cif.gz_C crystal structure of putative bacterial transcription regulation protein (np_372959.1) from staphylococcus aureus mu50 at 1.81 a resolution 0.7551 1 156
5kat-assembly1.cif.gz_A the structure of sav2435 bound to tetraphenylphosphonium 0.7527 3 157
5xbi-assembly1.cif.gz_A the structure of brlr-c domain bound to 3-amino-2-phenazino(a pyocyanin analog) 0.7053 5 157
ID Description Score Start End Superfamily
af_Q2FY65_138_294_3.20.80.10 Alpha Beta;Alpha-Beta Barrel;Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A;Regulatory factor, effector binding domain 0.7942 3 159 3.20.80.10
af_Q2FY65_138_294_3.20.80.10 Alpha Beta;Alpha-Beta Barrel;Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A;Regulatory factor, effector binding domain 0.7809 3 159 3.20.80.10
3lurB00 Alpha Beta;Alpha-Beta Barrel;Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A;Regulatory factor, effector binding domain 0.7428 3 157 3.20.80.10
3lurB00 Alpha Beta;Alpha-Beta Barrel;Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A;Regulatory factor, effector binding domain 0.7302 3 157 3.20.80.10
1d5yB03 Alpha Beta;Alpha-Beta Barrel;Multidrug-efflux Transporter 1 Regulator Bmrr; Chain A;Regulatory factor, effector binding domain 0.6553 1 159 3.20.80.10
ID Description Score Start End GO Terms
AF-A0A328WHW9-F1-model_v4 Integron-associated effector binding protein domain-containing protein 0.9836 1 100
AF-A0A328WHW9-F1-model_v4 Integron-associated effector binding protein domain-containing protein 0.9463 1 100
AF-A0A3N4GDX6-F1-model_v4 Transcriptional regulator 0.94 1 159
AF-G4HK94-F1-model_v4 Transcription activator effector binding 0.9396 2 159
AF-A0A6M1X837-F1-model_v4 deleted 0.9383 1 137

Feature Viewer

pLDDT pTM Quality
91.53 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map