F214752

General Info

Members Datasets Scaffolds Average Seq Length
152 79 151 244

Family's Representative Sequence

Representative Sequence 3300031616|Ga0307508_10000551|Ga0307508_1000055126
Length 292
Sequence MQQVGVGFHTDVVAGVETGDHLSVHPNWSDDRFQLHEYGKVPPRNVTLPGDVMTAPAVNTSLTPQPGHLYVVATPIGNLADLSDRARAILGNVDMVACEDTRTTGAMLTRFGLHRELIAYHDHNETEVAEKLSELIAAGKSIAVVSDAGTPGLSDPGFRIVRACRRRNLPVVPVPGACALIAVISASGLPTNGFFFAGFLTPKTAARVAFLEKYRDFDYTLALYESCHRIDKFAAEIVETLGPGRVVCIAKEVTKLHETFLIGIAGDVQARLMKGSLKGEFVVLIAPKDFVL

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
13 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
14 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
15 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
16 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
17 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
18 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
28 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
29 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
30 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
31 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
32 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
33 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
34 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
35 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
36 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
37 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
38 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
39 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
40 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
41 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
42 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
43 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
44 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
45 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
46 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
47 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
48 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
49 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
50 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
51 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
52 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
56 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
57 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
58 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
59 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
60 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
61 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
62 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
66 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
67 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
74 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
75 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
76 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
78 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
79 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.32
Nodule 0
Rhizoplane 0
Rhizosphere 94.08
Stem 0
Stem Tuber 0
Unclassified 4.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10018088 3300003320 Bacteria 9330
2 rootH2_10063437 3300003320 Bacteria 6542
3 rootL2_10071248 3300003322 Bacteria 1772
4 rootH1_10348700 3300003323 Bacteria 2838
5 Ga0070683_100060915 3300005329 Bacteria 3508
6 Ga0070683_100139521 3300005329 Bacteria 2296
7 Ga0068869_100003914 3300005334 Bacteria 9189
8 Ga0068868_100011510 3300005338 Bacteria 6444
9 Ga0068867_100013586 3300005459 Bacteria 5766
10 Ga0070684_100093130 3300005535 Bacteria 2682
11 Ga0068857_100165329 3300005577 Bacteria 2009
12 Ga0068856_100013093 3300005614 Bacteria 8032
13 Ga0068856_100026497 3300005614 Bacteria 5652
14 Ga0070717_10000693 3300006028 Bacteria 21709
15 Ga0070712_100607309 3300006175 Bacteria 926
16 Ga0068871_100108085 3300006358 Bacteria 2337
17 Ga0068865_100001451 3300006881 Bacteria 13795
18 Ga0105240_10273898 3300009093 Unclassified 1942
19 Ga0163163_10243816 3300014325 Bacteria 1847
20 Ga0207693_10087172 3300025915 Unclassified 2446
21 Ga0207704_10001116 3300025938 Bacteria 11955
22 Ga0207691_10565636 3300025940 Bacteria 963
23 Ga0207689_10008223 3300025942 Bacteria 9091
24 Ga0207661_10085773 3300025944 Bacteria 2611
25 Ga0207677_10004937 3300026023 Bacteria 7205
26 Ga0207702_10018816 3300026078 Bacteria 5713
27 Ga0207702_10666072 3300026078 Bacteria 1024
28 Ga0207648_10006127 3300026089 Bacteria 11989
29 Ga0207674_10028947 3300026116 Bacteria 5839
30 Ga0265337_1004081 3300028556 Bacteria 6146
31 Ga0265337_1007481 3300028556 Bacteria 4085
32 Ga0265319_1000119 3300028563 Bacteria 59920
33 Ga0265319_1010072 3300028563 Bacteria 3964
34 Ga0265319_1013814 3300028563 Bacteria 3192
35 Ga0265319_1019618 3300028563 Bacteria 2520
36 Ga0265334_10001415 3300028573 Bacteria 11541
37 Ga0265334_10010604 3300028573 Bacteria 3890
38 Ga0265334_10049677 3300028573 Bacteria 1613
39 Ga0265318_10000002 3300028577 Bacteria 428208
40 Ga0265318_10002964 3300028577 Bacteria 8789
41 Ga0265318_10006544 3300028577 Bacteria 5349
42 Ga0265318_10012036 3300028577 Bacteria 3696
43 Ga0265318_10013244 3300028577 Bacteria 3493
44 Ga0265318_10013606 3300028577 Bacteria 3431
45 Ga0265318_10139236 3300028577 Bacteria 891
46 Ga0265323_10000231 3300028653 Bacteria 32862
47 Ga0265323_10008207 3300028653 Bacteria 4318
48 Ga0265323_10035377 3300028653 Bacteria 1841
49 Ga0265322_10001871 3300028654 Bacteria 6658
50 Ga0307515_10031058 3300028794 Bacteria 8929
51 Ga0265338_10002472 3300028800 Bacteria 27606
52 Ga0265338_10138236 3300028800 Bacteria 1911
53 Ga0265324_10001609 3300029957 Bacteria 12569
54 Ga0265324_10010914 3300029957 Bacteria 3482
55 Ga0265324_10023123 3300029957 Bacteria 2216
56 Ga0265332_10059849 3300031238 Bacteria 1630
57 Ga0265332_10092237 3300031238 Bacteria 1280
58 Ga0265328_10035723 3300031239 Bacteria 1837
59 Ga0265328_10059550 3300031239 Bacteria 1402
60 Ga0265328_10085810 3300031239 Bacteria 1162
61 Ga0265320_10003488 3300031240 Bacteria 10542
62 Ga0265320_10003892 3300031240 Bacteria 9874
63 Ga0265320_10011921 3300031240 Bacteria 5090
64 Ga0265320_10031719 3300031240 Bacteria 2712
65 Ga0265320_10124236 3300031240 Bacteria 1175
66 Ga0265325_10007778 3300031241 Bacteria 6384
67 Ga0265325_10072648 3300031241 Bacteria 1723
68 Ga0265340_10076276 3300031247 Unclassified 1583
69 Ga0265340_10090055 3300031247 Bacteria 1435
70 Ga0265339_10091172 3300031249 Bacteria 1597
71 Ga0265331_10072886 3300031250 Bacteria 1604
72 Ga0265331_10120752 3300031250 Unclassified 1198
73 Ga0265327_10000016 3300031251 Bacteria 467439
74 Ga0265327_10006133 3300031251 Bacteria 9726
75 Ga0265327_10020048 3300031251 Bacteria 4089
76 Ga0265327_10025419 3300031251 Bacteria 3452
77 Ga0265316_10014144 3300031344 Bacteria 7038
78 Ga0265316_10041788 3300031344 Bacteria 3667
79 Ga0265316_10047541 3300031344 Bacteria 3394
80 Ga0265316_10049713 3300031344 Bacteria 3301
81 Ga0265316_10060407 3300031344 Bacteria 2946
82 Ga0265316_10276669 3300031344 Bacteria 1227
83 Ga0265316_10279687 3300031344 Unclassified 1219
84 Ga0307408_100000017 3300031548 Bacteria 355890
85 Ga0265313_10001838 3300031595 Bacteria 19354
86 Ga0265313_10002523 3300031595 Bacteria 15713
87 Ga0265313_10004315 3300031595 Bacteria 11007
88 Ga0265313_10004361 3300031595 Bacteria 10920
89 Ga0265313_10021223 3300031595 Bacteria 3557
90 Ga0307508_10000551 3300031616 Bacteria 44445
91 Ga0265314_10001237 3300031711 Bacteria 29138
92 Ga0265314_10002381 3300031711 Bacteria 19346
93 Ga0265314_10010059 3300031711 Bacteria 7929
94 Ga0265314_10026629 3300031711 Bacteria 4341
95 Ga0265314_10050191 3300031711 Bacteria 2916
96 Ga0265314_10094699 3300031711 Bacteria 1935
97 Ga0265342_10015432 3300031712 Bacteria 5024
98 Ga0265342_10020241 3300031712 Bacteria 4274
99 Ga0265342_10049292 3300031712 Bacteria 2520
100 Ga0307413_10096390 3300031824 Bacteria 1942
101 Ga0307410_10000096 3300031852 Bacteria 30297
102 Ga0307407_10026537 3300031903 Bacteria 3069
103 Ga0307409_100000090 3300031995 Bacteria 32438
104 Ga0307416_100000034 3300032002 Bacteria 155632
105 Ga0395905_0000015 3300037471 Bacteria 393880
106 Ga0439445_0061110 3300042004 Bacteria 1030
107 Ga0451577_0000012 3300042876 Bacteria 575467
108 Ga0451577_0388108 3300042876 Bacteria 1267
109 Ga0453684_0000001 3300044712 Bacteria 2623166
110 Ga0453684_0013954 3300044712 Bacteria 12950
111 Ga0453684_0224612 3300044712 Bacteria 2173
112 Ga0453684_0818593 3300044712 Bacteria 1003
113 Ga0451576_0000730 3300045051 Bacteria 65921
114 Ga0451576_0001701 3300045051 Bacteria 36350
115 Ga0451576_0006194 3300045051 Bacteria 14732
116 Ga0466967_0017200 3300045976 Bacteria 5733
117 Ga0495621_0076548 3300046539 Bacteria 1241
118 Ga0501032_0017188 3300049569 Bacteria 5082
119 Ga0501032_0023299 3300049569 Bacteria 4282
120 Ga0501033_0000994 3300049570 Bacteria 25827
121 Ga0501033_0001469 3300049570 Bacteria 20881
122 Ga0501034_0132944 3300049571 Bacteria 2471
123 Ga0501036_0010398 3300049572 Bacteria 7682
124 Ga0501036_0129904 3300049572 Bacteria 2127
125 Ga0501038_0005588 3300049574 Bacteria 11667
126 Ga0501039_0037861 3300049575 Bacteria 3725
127 Ga0501042_0006429 3300049578 Bacteria 7624
128 Ga0501043_0016854 3300049579 Bacteria 5726
129 Ga0501043_0260969 3300049579 Bacteria 1332
130 Ga0501043_0274396 3300049579 Bacteria 1294
131 Ga0501046_0014863 3300049580 Bacteria 6553
132 Ga0501046_0030360 3300049580 Bacteria 4386
133 Ga0501046_0044202 3300049580 Bacteria 3543
134 Ga0501047_0019673 3300049581 Bacteria 6478
135 Ga0501047_0038535 3300049581 Bacteria 4624
136 Ga0501048_0009412 3300049582 Bacteria 7337
137 Ga0501068_0101844 3300049584 Bacteria 1780
138 Ga0501070_0142464 3300049586 Bacteria 1979
139 Ga0501070_0328570 3300049586 Bacteria 1243
140 Ga0501083_0012060 3300049744 Bacteria 6052
141 Ga0501083_0014377 3300049744 Bacteria 5533
142 Ga0501083_0062372 3300049744 Bacteria 2487
143 Ga0501083_0136811 3300049744 Bacteria 1605
144 Ga0501035_0003295 3300049822 Bacteria 15478
145 Ga0501035_0028654 3300049822 Bacteria 5082
146 Ga0501044_0000050 3300049823 Bacteria 143754
147 Ga0501044_0002048 3300049823 Bacteria 23260
148 Ga0501044_0009042 3300049823 Bacteria 10889
149 Ga0501044_0105910 3300049823 Bacteria 2824
150 Ga0500568_0012427 3300053139 Bacteria 3918
151 Ga0500622_0003853 3300053156 Bacteria 9749

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10071248 rootL2_100712481 236
2 3300005329 Ga0070683_100139521 Ga0070683_1001395213 236
3 3300005535 Ga0070684_100093130 Ga0070684_1000931302 236
4 3300005614 Ga0068856_100013093 Ga0068856_1000130933 236
5 3300009093 Ga0105240_10273898 Ga0105240_102738982 236
6 3300026078 Ga0207702_10666072 Ga0207702_106660721 236
7 3300028573 Ga0265334_10010604 Ga0265334_100106043 236
8 3300028573 Ga0265334_10049677 Ga0265334_100496773 236
9 3300028653 Ga0265323_10000231 Ga0265323_1000023126 236
10 3300028653 Ga0265323_10035377 Ga0265323_100353773 236
11 3300028654 Ga0265322_10001871 Ga0265322_100018712 236
12 3300031239 Ga0265328_10059550 Ga0265328_100595502 236
13 3300031240 Ga0265320_10124236 Ga0265320_101242362 236
14 3300031344 Ga0265316_10014144 Ga0265316_100141444 236
15 3300031344 Ga0265316_10047541 Ga0265316_100475413 236
16 3300031595 Ga0265313_10004315 Ga0265313_100043157 236
17 3300031595 Ga0265313_10004361 Ga0265313_100043619 236
18 3300031711 Ga0265314_10010059 Ga0265314_100100595 236
19 3300031711 Ga0265314_10050191 Ga0265314_100501913 236
20 3300031712 Ga0265342_10015432 Ga0265342_100154322 236
21 3300031712 Ga0265342_10049292 Ga0265342_100492922 236
22 3300031824 Ga0307413_10096390 Ga0307413_100963902 236
23 3300042876 Ga0451577_0388108 Ga0451577_0388108_96_806 236
24 3300045051 Ga0451576_0000730 Ga0451576_0000730_20850_21560 236
25 3300045051 Ga0451576_0001701 Ga0451576_0001701_2607_3317 236
26 3300045051 Ga0451576_0006194 Ga0451576_0006194_4941_5651 236
27 3300046539 Ga0495621_0076548 Ga0495621_0076548_83_793 236
28 3300049579 Ga0501043_0274396 Ga0501043_0274396_437_1147 236
29 3300049823 Ga0501044_0002048 Ga0501044_0002048_1829_2539 236
30 iso_pu_bacteria 2786546940 2788436658 236
31 3300025940 Ga0207691_10565636 Ga0207691_105656361 237
32 3300028563 Ga0265319_1010072 Ga0265319_10100722 237
33 3300031250 Ga0265331_10120752 Ga0265331_101207523 237
34 3300049744 Ga0501083_0012060 Ga0501083_0012060_1462_2340 237
35 3300049744 Ga0501083_0014377 Ga0501083_0014377_3244_3957 237
36 3300003320 rootH2_10018088 rootH2_100180889 238
37 3300003320 rootH2_10063437 rootH2_100634376 238
38 3300003323 rootH1_10348700 rootH1_103487002 238
39 3300005329 Ga0070683_100060915 Ga0070683_1000609154 238
40 3300005334 Ga0068869_100003914 Ga0068869_1000039142 238
41 3300005338 Ga0068868_100011510 Ga0068868_1000115105 238
42 3300005459 Ga0068867_100013586 Ga0068867_1000135863 238
43 3300005577 Ga0068857_100165329 Ga0068857_1001653293 238
44 3300005614 Ga0068856_100026497 Ga0068856_1000264974 238
45 3300006028 Ga0070717_10000693 Ga0070717_1000069317 238
46 3300006175 Ga0070712_100607309 Ga0070712_1006073092 238
47 3300006358 Ga0068871_100108085 Ga0068871_1001080853 238
48 3300006881 Ga0068865_100001451 Ga0068865_1000014516 238
49 3300014325 Ga0163163_10243816 Ga0163163_102438162 238
50 3300025915 Ga0207693_10087172 Ga0207693_100871721 238
51 3300025938 Ga0207704_10001116 Ga0207704_100011166 238
52 3300025942 Ga0207689_10008223 Ga0207689_1000822311 238
53 3300025944 Ga0207661_10085773 Ga0207661_100857733 238
54 3300026023 Ga0207677_10004937 Ga0207677_100049374 238
55 3300026078 Ga0207702_10018816 Ga0207702_100188163 238
56 3300026089 Ga0207648_10006127 Ga0207648_1000612710 238
57 3300026116 Ga0207674_10028947 Ga0207674_100289471 238
58 3300028556 Ga0265337_1004081 Ga0265337_10040815 238
59 3300028556 Ga0265337_1007481 Ga0265337_10074812 238
60 3300028563 Ga0265319_1000119 Ga0265319_100011920 238
61 3300028563 Ga0265319_1013814 Ga0265319_10138144 238
62 3300028563 Ga0265319_1019618 Ga0265319_10196183 238
63 3300028573 Ga0265334_10001415 Ga0265334_100014157 238
64 3300028577 Ga0265318_10000002 Ga0265318_10000002344 238
65 3300028577 Ga0265318_10002964 Ga0265318_100029649 238
66 3300028577 Ga0265318_10006544 Ga0265318_100065445 238
67 3300028577 Ga0265318_10012036 Ga0265318_100120362 238
68 3300028577 Ga0265318_10013244 Ga0265318_100132444 238
69 3300028577 Ga0265318_10013606 Ga0265318_100136063 238
70 3300028577 Ga0265318_10139236 Ga0265318_101392361 238
71 3300028653 Ga0265323_10008207 Ga0265323_100082074 238
72 3300028794 Ga0307515_10031058 Ga0307515_100310588 238
73 3300028800 Ga0265338_10002472 Ga0265338_1000247217 238
74 3300028800 Ga0265338_10138236 Ga0265338_101382362 238
75 3300029957 Ga0265324_10001609 Ga0265324_100016092 238
76 3300029957 Ga0265324_10010914 Ga0265324_100109143 238
77 3300029957 Ga0265324_10023123 Ga0265324_100231231 238
78 3300031238 Ga0265332_10059849 Ga0265332_100598492 238
79 3300031238 Ga0265332_10092237 Ga0265332_100922372 238
80 3300031239 Ga0265328_10035723 Ga0265328_100357232 238
81 3300031239 Ga0265328_10085810 Ga0265328_100858101 238
82 3300031240 Ga0265320_10003488 Ga0265320_100034888 238
83 3300031240 Ga0265320_10003892 Ga0265320_100038922 238
84 3300031240 Ga0265320_10011921 Ga0265320_100119213 238
85 3300031240 Ga0265320_10031719 Ga0265320_100317193 238
86 3300031241 Ga0265325_10007778 Ga0265325_100077786 238
87 3300031241 Ga0265325_10072648 Ga0265325_100726482 238
88 3300031247 Ga0265340_10076276 Ga0265340_100762762 238
89 3300031247 Ga0265340_10090055 Ga0265340_100900551 238
90 3300031249 Ga0265339_10091172 Ga0265339_100911722 238
91 3300031250 Ga0265331_10072886 Ga0265331_100728862 238
92 3300031251 Ga0265327_10000016 Ga0265327_1000001680 238
93 3300031251 Ga0265327_10006133 Ga0265327_100061336 238
94 3300031251 Ga0265327_10020048 Ga0265327_100200484 238
95 3300031251 Ga0265327_10025419 Ga0265327_100254193 238
96 3300031344 Ga0265316_10041788 Ga0265316_100417883 238
97 3300031344 Ga0265316_10049713 Ga0265316_100497134 238
98 3300031344 Ga0265316_10060407 Ga0265316_100604073 238
99 3300031344 Ga0265316_10276669 Ga0265316_102766691 238
100 3300031344 Ga0265316_10279687 Ga0265316_102796871 238
101 3300031548 Ga0307408_100000017 Ga0307408_10000001744 238
102 3300031595 Ga0265313_10001838 Ga0265313_100018389 238
103 3300031595 Ga0265313_10002523 Ga0265313_100025235 238
104 3300031595 Ga0265313_10021223 Ga0265313_100212232 238
105 3300031616 Ga0307508_10000551 Ga0307508_1000055126 238
106 3300031711 Ga0265314_10001237 Ga0265314_1000123722 238
107 3300031711 Ga0265314_10002381 Ga0265314_100023815 238
108 3300031711 Ga0265314_10026629 Ga0265314_100266292 238
109 3300031711 Ga0265314_10094699 Ga0265314_100946991 238
110 3300031712 Ga0265342_10020241 Ga0265342_100202413 238
111 3300031852 Ga0307410_10000096 Ga0307410_100000964 238
112 3300031903 Ga0307407_10026537 Ga0307407_100265374 238
113 3300031995 Ga0307409_100000090 Ga0307409_1000000905 238
114 3300032002 Ga0307416_100000034 Ga0307416_10000003433 238
115 3300037471 Ga0395905_0000015 Ga0395905_0000015_332962_333684 238
116 3300042004 Ga0439445_0061110 Ga0439445_0061110_267_989 238
117 3300042876 Ga0451577_0000012 Ga0451577_0000012_187230_187952 238
118 3300044712 Ga0453684_0000001 Ga0453684_0000001_924488_925204 238
119 3300044712 Ga0453684_0013954 Ga0453684_0013954_7996_8718 238
120 3300044712 Ga0453684_0224612 Ga0453684_0224612_828_1550 238
121 3300044712 Ga0453684_0818593 Ga0453684_0818593_46_768 238
122 3300045976 Ga0466967_0017200 Ga0466967_0017200_4009_4725 238
123 3300049569 Ga0501032_0017188 Ga0501032_0017188_2496_3299 238
124 3300049569 Ga0501032_0023299 Ga0501032_0023299_3213_3935 238
125 3300049570 Ga0501033_0000994 Ga0501033_0000994_21116_21919 238
126 3300049570 Ga0501033_0001469 Ga0501033_0001469_13989_14711 238
127 3300049571 Ga0501034_0132944 Ga0501034_0132944_994_1716 238
128 3300049572 Ga0501036_0010398 Ga0501036_0010398_5316_6119 238
129 3300049572 Ga0501036_0129904 Ga0501036_0129904_439_1161 238
130 3300049574 Ga0501038_0005588 Ga0501038_0005588_4389_5192 238
131 3300049575 Ga0501039_0037861 Ga0501039_0037861_1221_2024 238
132 3300049578 Ga0501042_0006429 Ga0501042_0006429_4293_5096 238
133 3300049579 Ga0501043_0016854 Ga0501043_0016854_1015_1818 238
134 3300049579 Ga0501043_0260969 Ga0501043_0260969_48_770 238
135 3300049580 Ga0501046_0014863 Ga0501046_0014863_5056_5859 238
136 3300049580 Ga0501046_0030360 Ga0501046_0030360_3572_4294 238
137 3300049580 Ga0501046_0044202 Ga0501046_0044202_2729_3451 238
138 3300049581 Ga0501047_0019673 Ga0501047_0019673_4544_5266 238
139 3300049581 Ga0501047_0038535 Ga0501047_0038535_2126_2848 238
140 3300049582 Ga0501048_0009412 Ga0501048_0009412_5220_6023 238
141 3300049584 Ga0501068_0101844 Ga0501068_0101844_327_1130 238
142 3300049586 Ga0501070_0142464 Ga0501070_0142464_1142_1945 238
143 3300049586 Ga0501070_0328570 Ga0501070_0328570_320_1042 238
144 3300049744 Ga0501083_0062372 Ga0501083_0062372_320_1042 238
145 3300049744 Ga0501083_0136811 Ga0501083_0136811_49_852 238
146 3300049822 Ga0501035_0003295 Ga0501035_0003295_2993_3715 238
147 3300049822 Ga0501035_0028654 Ga0501035_0028654_2496_3299 238
148 3300049823 Ga0501044_0000050 Ga0501044_0000050_80661_81383 238
149 3300049823 Ga0501044_0009042 Ga0501044_0009042_7469_8272 238
150 3300049823 Ga0501044_0105910 Ga0501044_0105910_1550_2272 238
151 3300053139 Ga0500568_0012427 Ga0500568_0012427_2883_3605 238
152 3300053156 Ga0500622_0003853 Ga0500622_0003853_4574_5296 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00590

TP_methylase

Tetrapyrrole (Corrin/Porphyrin) Methylases

68

269

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hh1-assembly2.cif.gz_C the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.9024 12 121
3hh1-assembly2.cif.gz_C the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.8859 12 121
3ffy-assembly1.cif.gz_A-2 putative tetrapyrrole (corrin/porphyrin) methyltransferase from bacteroides fragilis. 0.8848 123 233
3hh1-assembly3.cif.gz_D the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.8757 12 121
3fq6-assembly1.cif.gz_A the crystal structure of a methyltransferase domain from bacteroides thetaiotaomicron vpi 0.8712 123 233
ID Description Score Start End Superfamily
5hw4C02 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9359 122 233 3.30.950.10
af_Q338C6_169_282_3.30.950.10 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9269 124 233 3.30.950.10
af_P9WGW7_115_230_3.30.950.10 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9182 122 238 3.30.950.10
af_A0A0R0K914_60_169_3.30.950.10 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9171 125 207 3.30.950.10
af_P9WGW7_115_230_3.30.950.10 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9107 122 238 3.30.950.10
ID Description Score Start End GO Terms
AF-A0A3B9PRS9-F1-model_v4 16S rRNA (Cytidine(1402)-2'-O)-methyltransferase 0.9648 122 238 GO:0008168
GO:0032259
AF-A0A6L3XXD8-F1-model_v4 16S rRNA (Cytidine(1402)-2'-O)-methyltransferase 0.9556 150 233 GO:0008168
GO:0032259
AF-A0A829MCN4-F1-model_v4 Tetrapyrrole (Corrin/Porphyrin) Methylases family protein 0.9508 127 233 GO:0005737
GO:0006364
GO:0008168
GO:0032259
AF-A0A3B9PRS9-F1-model_v4 16S rRNA (Cytidine(1402)-2'-O)-methyltransferase 0.949 122 238 GO:0008168
GO:0032259
AF-A0A2M7E8N8-F1-model_v4 16S rRNA (Cytidine(1402)-2'-O)-methyltransferase 0.9458 134 233 GO:0005737
GO:0006364
GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
82.11 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map