F214419

General Info

Members Datasets Scaffolds Average Seq Length
152 80 304 283

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10006542|Ga0213876_100065424
Length 304
Sequence MDSASAGLGLIDLHAHTNESDGTLTPAELINLAHQTGLDALAITDHDTFSGYEKARPFADTVKLNLVRGIELNTRMGRDSALKIHAVHLLAYFPVNEPTAAFTAWLENERLERRNRNEGLAKRLQGDGIDITLEDVESRGRSLAGRPHFARLLVEKGYARNSEEAFSKYLGETAPSFVPRQSKTAEEVIGIVRSAGGVPVIAHPVRLGLTRAEERELLLRYRRAGLLGLEIYHSEHPPELQAYYRQLAEELQLLPTGGSDFHGAIKPDIQLGTGRNRNIRVPARFLEDMRGIRTPDAPRRIERA

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
36 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
37 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
38 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
39 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
60 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
61 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
62 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
63 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
64 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
66 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
67 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
70 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
71 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
72 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
73 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
76 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
77 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
78 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
79 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
80 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.97
Rhizosphere 69.08
Stem 0
Stem Tuber 0
Unclassified 26.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10006542 3300021384 Bacteria 6355
2 Ga0070658_10004844 3300005327 Bacteria 10959
3 Ga0070680_100326506 3300005336 Unclassified 1303
4 Ga0070660_100221721 3300005339 Bacteria 1537
5 Ga0070660_100322637 3300005339 Unclassified 1269
6 Ga0070673_100066936 3300005364 Unclassified 2871
7 Ga0070659_100022950 3300005366 Bacteria 4770
8 Ga0070659_100044599 3300005366 Unclassified 3472
9 Ga0070714_100050223 3300005435 Bacteria 3552
10 Ga0070714_100107461 3300005435 Bacteria 2466
11 Ga0070713_100349224 3300005436 Bacteria 1372
12 Ga0070711_100058196 3300005439 Bacteria 2679
13 Ga0070663_100053430 3300005455 Bacteria 2884
14 Ga0070662_100027831 3300005457 Unclassified 3930
15 Ga0070681_10019508 3300005458 Bacteria 6788
16 Ga0070681_10227405 3300005458 Unclassified 1780
17 Ga0070681_10481110 3300005458 Unclassified 1154
18 Ga0070699_100189197 3300005518 Bacteria 1828
19 Ga0070679_100098975 3300005530 Bacteria 2903
20 Ga0070696_100000642 3300005546 Bacteria 22341
21 Ga0070665_100105229 3300005548 Unclassified 2824
22 Ga0070665_100132066 3300005548 Bacteria 2499
23 Ga0068855_100053854 3300005563 Bacteria 4733
24 Ga0068856_100004563 3300005614 Bacteria 13759
25 Ga0068856_100019267 3300005614 Bacteria 6623
26 Ga0068856_100116706 3300005614 Bacteria 2670
27 Ga0068856_100156164 3300005614 Bacteria 2292
28 Ga0068858_100159037 3300005842 Bacteria 2127
29 Ga0068858_100253444 3300005842 Bacteria 1672
30 Ga0081455_10020389 3300005937 Bacteria 6242
31 Ga0081539_10059787 3300005985 Bacteria 2095
32 Ga0070717_10016119 3300006028 Bacteria 5788
33 Ga0075431_100148812 3300006847 Bacteria 2411
34 Ga0075431_100624405 3300006847 Bacteria 1060
35 Ga0075429_100223328 3300006880 Bacteria 1650
36 Ga0105240_10002313 3300009093 Bacteria 30847
37 Ga0105240_10062672 3300009093 Bacteria 4628
38 Ga0105240_10084088 3300009093 Unclassified 3903
39 Ga0114129_10266563 3300009147 Bacteria 2293
40 Ga0114129_11005704 3300009147 Bacteria 1050
41 Ga0105242_10268479 3300009176 Bacteria 1544
42 Ga0105248_10395137 3300009177 Bacteria 1557
43 Ga0105237_10004807 3300009545 Bacteria 15522
44 Ga0105237_10338148 3300009545 Unclassified 1510
45 Ga0105249_10038970 3300009553 Bacteria 4313
46 Ga0157369_10021909 3300013105 Bacteria 7143
47 Ga0157369_10237769 3300013105 Unclassified 1903
48 Ga0157374_10002666 3300013296 Bacteria 15033
49 Ga0157372_10067650 3300013307 Unclassified 4014
50 Ga0157372_10270264 3300013307 Unclassified 1975
51 Ga0163163_10569290 3300014325 Bacteria 1196
52 Ga0213873_10014576 3300021358 Bacteria 1744
53 Ga0213872_10000239 3300021361 Bacteria 48382
54 Ga0213874_10012867 3300021377 Bacteria 2156
55 Ga0213876_10002358 3300021384 Bacteria 11114
56 Ga0213876_10011791 3300021384 Unclassified 4660
57 Ga0213875_10000018 3300021388 Bacteria 233445
58 Ga0213875_10000024 3300021388 Bacteria 200333
59 Ga0213875_10001466 3300021388 Bacteria 15270
60 Ga0213875_10006557 3300021388 Bacteria 6093
61 Ga0213875_10016149 3300021388 Bacteria 3622
62 Ga0213875_10018818 3300021388 Bacteria 3326
63 Ga0213875_10032917 3300021388 Unclassified 2448
64 Ga0213875_10040206 3300021388 Unclassified 2202
65 Ga0213875_10094252 3300021388 Bacteria 1396
66 Ga0213875_10103180 3300021388 Bacteria 1331
67 Ga0213871_10023006 3300021441 Unclassified 1566
68 Ga0213871_10031669 3300021441 Bacteria 1382
69 Ga0207705_10088001 3300025909 Bacteria 2272
70 Ga0207707_10166417 3300025912 Bacteria 1927
71 Ga0207707_10184316 3300025912 Bacteria 1822
72 Ga0207695_10037990 3300025913 Bacteria 5191
73 Ga0207671_10161967 3300025914 Bacteria 1733
74 Ga0207652_10114805 3300025921 Bacteria 2392
75 Ga0207700_10118674 3300025928 Unclassified 2141
76 Ga0207664_10045602 3300025929 Bacteria 3439
77 Ga0207644_10073825 3300025931 Bacteria 2502
78 Ga0207706_10049338 3300025933 Unclassified 3720
79 Ga0207711_10333768 3300025941 Bacteria 1402
80 Ga0207651_10042743 3300025960 Unclassified 3019
81 Ga0207712_10157846 3300025961 Bacteria 1759
82 Ga0207703_10224321 3300026035 Bacteria 1682
83 Ga0207639_10025912 3300026041 Unclassified 4256
84 Ga0207678_10065466 3300026067 Bacteria 3121
85 Ga0207702_10002304 3300026078 Bacteria 18273
86 Ga0207702_10018834 3300026078 Bacteria 5710
87 Ga0207702_10046787 3300026078 Unclassified 3643
88 Ga0207702_10091050 3300026078 Bacteria 2670
89 Ga0207702_10483140 3300026078 Bacteria 1206
90 Ga0207641_10012482 3300026088 Bacteria 6964
91 Ga0207674_10183368 3300026116 Bacteria 2044
92 Ga0268266_10175841 3300028379 Unclassified 1946
93 Ga0268266_10252349 3300028379 Unclassified 1632
94 Ga0265325_10033295 3300031241 Unclassified 2748
95 Ga0373945_0037896 3300035116 Bacteria 1732
96 Ga0373935_0010005 3300035692 Bacteria 5682
97 Ga0373927_0004791 3300035695 Bacteria 9416
98 Ga0373947_0005506 3300035725 Bacteria 7388
99 Ga0373947_0051697 3300035725 Bacteria 2473
100 Ga0373925_0000170 3300037068 Bacteria 70413
101 Ga0373925_0099028 3300037068 Bacteria 2238
102 Ga0436364_0036536 3300037853 Bacteria 11807
103 Ga0436364_0043331 3300037853 Bacteria 2718
104 Ga0436364_0104692 3300037853 Bacteria 34412
105 Ga0436364_0158068 3300037853 Bacteria 183638
106 Ga0436364_0185503 3300037853 Bacteria 2197
107 Ga0436364_0189242 3300037853 Bacteria 9209
108 Ga0436364_0245958 3300037853 Bacteria 3286
109 Ga0436364_0268994 3300037853 Unclassified 1165
110 Ga0436364_0376223 3300037853 Bacteria 1715
111 Ga0436364_0724935 3300037853 Bacteria 7203
112 Ga0436364_0741363 3300037853 Bacteria 50058
113 Ga0436364_0837501 3300037853 Unclassified 3313
114 Ga0436364_0869053 3300037853 Unclassified 1549
115 Ga0436364_0991316 3300037853 Bacteria 187962
116 Ga0436364_1075105 3300037853 Unclassified 3413
117 Ga0436364_1120776 3300037853 Unclassified 1969
118 Ga0436364_1283950 3300037853 Bacteria 2108
119 Ga0436364_1506755 3300037853 Bacteria 2623
120 Ga0436364_1540153 3300037853 Bacteria 4729
121 Ga0400484_33648 3300038725 Bacteria 11907
122 Ga0400490_15417 3300038726 Bacteria 7928
123 Ga0436365_0407227 3300039437 Unclassified 3825
124 Ga0436365_0445110 3300039437 Bacteria 71153
125 Ga0436365_0521854 3300039437 Bacteria 4805
126 Ga0436360_0079241 3300039438 Bacteria 3793
127 Ga0436360_0464869 3300039438 Bacteria 1060
128 Ga0436360_0767073 3300039438 Bacteria 11683
129 Ga0436360_0800679 3300039438 Bacteria 6855
130 Ga0436361_0863641 3300039447 Bacteria 83672
131 Ga0436363_0085494 3300039450 Unclassified 3432
132 Ga0436363_0163958 3300039450 Bacteria 1815
133 Ga0436363_0312707 3300039450 Bacteria 6254
134 Ga0436363_0991508 3300039450 Unclassified 2996
135 Ga0436363_1063556 3300039450 Unclassified 2875
136 Ga0436363_1682801 3300039450 Unclassified 1273
137 Ga0436362_0005128 3300039453 Bacteria 3996
138 Ga0436362_0195346 3300039453 Bacteria 1711
139 Ga0436362_0469492 3300039453 Unclassified 1171
140 Ga0436362_0579911 3300039453 Bacteria 3650
141 Ga0436362_0964337 3300039453 Bacteria 2602
142 Ga0436362_0975890 3300039453 Bacteria 1136
143 Ga0436362_1012864 3300039453 Bacteria 1959
144 Ga0466966_0165337 3300044684 Bacteria 1346
145 Ga0466967_0128876 3300045976 Unclassified 2347
146 Ga0495674_0244576 3300047319 Bacteria 1478
147 Ga0496109_0466695 3300048912 Unclassified 1192
148 Ga0496110_0058923 3300048913 Unclassified 3383
149 Ga0496112_0028712 3300048915 Bacteria 5372
150 Ga0501249_021437 3300049679 Unclassified 1409
151 nmdc:mga06r32_22576_c1 3300050510 Bacteria 5819
152 nmdc:mga06r32_560987_c1 3300050510 Bacteria 1115
153 Ga0213876_10006542
154 Ga0070658_10004844
155 Ga0070680_100326506
156 Ga0070660_100221721
157 Ga0070660_100322637
158 Ga0070673_100066936
159 Ga0070659_100022950
160 Ga0070659_100044599
161 Ga0070714_100050223
162 Ga0070714_100107461
163 Ga0070713_100349224
164 Ga0070711_100058196
165 Ga0070663_100053430
166 Ga0070662_100027831
167 Ga0070681_10019508
168 Ga0070681_10227405
169 Ga0070681_10481110
170 Ga0070699_100189197
171 Ga0070679_100098975
172 Ga0070696_100000642
173 Ga0070665_100105229
174 Ga0070665_100132066
175 Ga0068855_100053854
176 Ga0068856_100004563
177 Ga0068856_100019267
178 Ga0068856_100116706
179 Ga0068856_100156164
180 Ga0068858_100159037
181 Ga0068858_100253444
182 Ga0081455_10020389
183 Ga0081539_10059787
184 Ga0070717_10016119
185 Ga0075431_100148812
186 Ga0075431_100624405
187 Ga0075429_100223328
188 Ga0105240_10002313
189 Ga0105240_10062672
190 Ga0105240_10084088
191 Ga0114129_10266563
192 Ga0114129_11005704
193 Ga0105242_10268479
194 Ga0105248_10395137
195 Ga0105237_10004807
196 Ga0105237_10338148
197 Ga0105249_10038970
198 Ga0157369_10021909
199 Ga0157369_10237769
200 Ga0157374_10002666
201 Ga0157372_10067650
202 Ga0157372_10270264
203 Ga0163163_10569290
204 Ga0213873_10014576
205 Ga0213872_10000239
206 Ga0213874_10012867
207 Ga0213876_10002358
208 Ga0213876_10011791
209 Ga0213875_10000018
210 Ga0213875_10000024
211 Ga0213875_10001466
212 Ga0213875_10006557
213 Ga0213875_10016149
214 Ga0213875_10018818
215 Ga0213875_10032917
216 Ga0213875_10040206
217 Ga0213875_10094252
218 Ga0213875_10103180
219 Ga0213871_10023006
220 Ga0213871_10031669
221 Ga0207705_10088001
222 Ga0207707_10166417
223 Ga0207707_10184316
224 Ga0207695_10037990
225 Ga0207671_10161967
226 Ga0207652_10114805
227 Ga0207700_10118674
228 Ga0207664_10045602
229 Ga0207644_10073825
230 Ga0207706_10049338
231 Ga0207711_10333768
232 Ga0207651_10042743
233 Ga0207712_10157846
234 Ga0207703_10224321
235 Ga0207639_10025912
236 Ga0207678_10065466
237 Ga0207702_10002304
238 Ga0207702_10018834
239 Ga0207702_10046787
240 Ga0207702_10091050
241 Ga0207702_10483140
242 Ga0207641_10012482
243 Ga0207674_10183368
244 Ga0268266_10175841
245 Ga0268266_10252349
246 Ga0265325_10033295
247 Ga0373945_0037896
248 Ga0373935_0010005
249 Ga0373927_0004791
250 Ga0373947_0005506
251 Ga0373947_0051697
252 Ga0373925_0000170
253 Ga0373925_0099028
254 Ga0436364_0036536
255 Ga0436364_0043331
256 Ga0436364_0104692
257 Ga0436364_0158068
258 Ga0436364_0185503
259 Ga0436364_0189242
260 Ga0436364_0245958
261 Ga0436364_0268994
262 Ga0436364_0376223
263 Ga0436364_0724935
264 Ga0436364_0741363
265 Ga0436364_0837501
266 Ga0436364_0869053
267 Ga0436364_0991316
268 Ga0436364_1075105
269 Ga0436364_1120776
270 Ga0436364_1283950
271 Ga0436364_1506755
272 Ga0436364_1540153
273 Ga0400484_33648
274 Ga0400490_15417
275 Ga0436365_0407227
276 Ga0436365_0445110
277 Ga0436365_0521854
278 Ga0436360_0079241
279 Ga0436360_0464869
280 Ga0436360_0767073
281 Ga0436360_0800679
282 Ga0436361_0863641
283 Ga0436363_0085494
284 Ga0436363_0163958
285 Ga0436363_0312707
286 Ga0436363_0991508
287 Ga0436363_1063556
288 Ga0436363_1682801
289 Ga0436362_0005128
290 Ga0436362_0195346
291 Ga0436362_0469492
292 Ga0436362_0579911
293 Ga0436362_0964337
294 Ga0436362_0975890
295 Ga0436362_1012864
296 Ga0466966_0165337
297 Ga0466967_0128876
298 Ga0495674_0244576
299 Ga0496109_0466695
300 Ga0496110_0058923
301 Ga0496112_0028712
302 Ga0501249_021437
303 nmdc:mga06r32_22576_c1
304 nmdc:mga06r32_560987_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02811

PHP

PHP domain

12

174

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ug9-assembly1.cif.gz_A crystal structure of rnase am php domain 0.894 1 269
7ug9-assembly1.cif.gz_A crystal structure of rnase am php domain 0.8441 1 269
7wtb-assembly1.cif.gz_A cryo-em structure of human pyruvate carboxylase with acetyl-coa 0.8067 197 243
7wta-assembly1.cif.gz_D cryo-em structure of human pyruvate carboxylase in apo state 0.8046 197 243
3hb9-assembly1.cif.gz_D crystal structure of s. aureus pyruvate carboxylase a610t mutant 0.7909 197 241
ID Description Score Start End Superfamily
2yb4A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.8866 98 166 1.10.150.650
2yb4A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8553 2 251 3.20.20.140
2yb4A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.832 98 166 1.10.150.650
3e0fA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8227 2 278 3.20.20.140
1ld3A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8092 17 59 3.40.50.1400
ID Description Score Start End GO Terms
AF-A0A1G8D4S1-F1-model_v4 Polymerase/histidinol phosphatase N-terminal domain-containing protein 0.9856 2 75 GO:0004534
GO:0035312
AF-A0A3B8TRU9-F1-model_v4 deleted 0.9845 2 77
AF-A0A2T7TMF1-F1-model_v4 Polymerase/histidinol phosphatase N-terminal domain-containing protein 0.977 2 78 GO:0004534
GO:0035312
AF-A0A838K408-F1-model_v4 PHP domain-containing protein 0.9756 1 78 GO:0004534
GO:0035312
AF-A0A2L0UEC6-F1-model_v4 Phosphatase 0.9737 2 73 GO:0004534
GO:0035312

Map