F214417

General Info

Members Datasets Scaffolds Average Seq Length
152 121 141 386

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10001195|Ga0213876_1000119512
Length 418
Sequence MRVAPAPTRPHRSAPPPPEVRARDEPNYGAGMRVAMMTREYPPEVYGGAGVHVTELVAQLRRLCTVDVHCMGEPRAGAIAHQPDPRLRGANMALSTLSSDLVMANAAAGATVAHSHTWYTGLAGHLAKLLLDIPHVLTAHSLEPLRPWKAEQLGGGYHVSTWVEHTAVLAADAVIAVSDGMAEDILRVYPRLDPSVVHVVRNGIDTDVWYPGGPPRTGSVLADLQVDPGRPVVAFVGRITRQKGVEHLVAAAHRFSPDVQVVLCAGAPDTPEIADAVGSAVAELAHYRSGVFWIRNMLPVGELREILSAATVFVCPSVYEPLGIVNLEAMACGTPVVASDVGGIPEVVVDGVTGTLVHYDPHDAAGYQAGLAQAVNELVADPDKARRFGQAGRQRCVEAFSWAHVAEQTLDIYRKVCA

Samples

Sample ID Description Type Environment
1 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
2 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
3 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
4 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
5 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
6 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
7 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
8 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
9 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
10 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
11 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
12 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
69 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
70 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
71 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
72 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
73 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
74 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
75 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
76 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
77 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
78 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
79 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
80 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
81 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
82 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
83 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
84 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
89 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
90 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
97 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
98 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
99 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
100 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
101 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
109 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
110 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
114 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
115 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
116 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
117 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
118 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
119 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
120 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
121 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.76
Metatranscriptomes 0
Isolates 7.24

Biome Distribution

Category Percentage (%)
Aerial Root 0.66
Bulb 0
Endosphere 7.24
Nodule 0.66
Rhizoplane 5.92
Rhizosphere 67.76
Stem 0
Stem Tuber 0
Unclassified 17.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000480 3300001977 Bacteria 5967
2 JGI24737J22298_10010147 3300001990 Bacteria 3119
3 JGI24745J21846_1001396 3300002073 Bacteria 2338
4 Ga0070658_10006993 3300005327 Bacteria 9113
5 Ga0068868_100113065 3300005338 Bacteria 2207
6 Ga0070689_100228880 3300005340 Bacteria 1527
7 Ga0070691_10028670 3300005341 Bacteria 2602
8 Ga0070692_10017335 3300005345 Bacteria 3441
9 Ga0070675_100048038 3300005354 Bacteria 3498
10 Ga0070659_100000118 3300005366 Bacteria 59407
11 Ga0070659_100072329 3300005366 Bacteria 2743
12 Ga0070667_100139276 3300005367 Bacteria 2123
13 Ga0070709_10113121 3300005434 Bacteria 1828
14 Ga0070714_100304251 3300005435 Bacteria 1487
15 Ga0070710_10010823 3300005437 Bacteria 4489
16 Ga0070705_100026413 3300005440 Bacteria 3160
17 Ga0070694_100025181 3300005444 Bacteria 3849
18 Ga0070707_100245374 3300005468 Bacteria 1743
19 Ga0068853_100015629 3300005539 Bacteria 6235
20 Ga0070696_100014372 3300005546 Bacteria 5311
21 Ga0070665_100078647 3300005548 Bacteria 3304
22 Ga0070704_100101598 3300005549 Bacteria 2168
23 Ga0068854_100220783 3300005578 Bacteria 1499
24 Ga0070702_100017223 3300005615 Bacteria 3723
25 Ga0068864_100041856 3300005618 Bacteria 3918
26 Ga0068863_100100386 3300005841 Bacteria 2751
27 Ga0068858_100048776 3300005842 Bacteria 3922
28 Ga0068860_100319245 3300005843 Bacteria 1524
29 Ga0075365_10014494 3300006038 Bacteria 4743
30 Ga0075368_10007848 3300006042 Bacteria 3783
31 Ga0075363_100013571 3300006048 Bacteria 3954
32 Ga0075364_10005916 3300006051 Bacteria 7149
33 Ga0075362_10056726 3300006177 Bacteria 1764
34 Ga0075370_10000494 3300006353 Bacteria 14916
35 Ga0075431_100102190 3300006847 Bacteria 2958
36 Ga0068865_100131411 3300006881 Bacteria 1876
37 Ga0105247_10020579 3300009101 Bacteria 3967
38 Ga0105243_10000243 3300009148 Bacteria 62451
39 Ga0105242_10081438 3300009176 Bacteria 2707
40 Ga0105246_10047295 3300011119 Bacteria 2937
41 Ga0157369_10001431 3300013105 Bacteria 29275
42 Ga0157369_10044550 3300013105 Bacteria 4828
43 Ga0157369_10080875 3300013105 Bacteria 3478
44 Ga0157375_10389619 3300013308 Bacteria 1560
45 Ga0157380_10039604 3300014326 Bacteria 3666
46 Ga0157379_10216612 3300014968 Bacteria 1734
47 Ga0213873_10000055 3300021358 Bacteria 25297
48 Ga0213876_10001195 3300021384 Bacteria 16414
49 Ga0213876_10013414 3300021384 Bacteria 4353
50 Ga0213876_10015880 3300021384 Bacteria 3985
51 Ga0213876_10016491 3300021384 Bacteria 3905
52 Ga0213875_10000111 3300021388 Bacteria 92836
53 Ga0213875_10011919 3300021388 Bacteria 4311
54 Ga0207688_10022757 3300025901 Bacteria 3431
55 Ga0207705_10005849 3300025909 Bacteria 9155
56 Ga0207660_10108041 3300025917 Bacteria 2089
57 Ga0207659_10075567 3300025926 Bacteria 2473
58 Ga0207664_10073571 3300025929 Bacteria 2758
59 Ga0207664_10269572 3300025929 Bacteria 1491
60 Ga0207690_10000437 3300025932 Bacteria 27119
61 Ga0207690_10007253 3300025932 Bacteria 6584
62 Ga0207709_10002717 3300025935 Bacteria 10935
63 Ga0207641_10126917 3300026088 Bacteria 2285
64 Ga0207676_10124070 3300026095 Bacteria 2183
65 Ga0268266_10343491 3300028379 Bacteria 1401
66 Ga0316576_10000546 3300031727 Bacteria 17678
67 Ga0316578_10114490 3300031728 Bacteria 1620
68 Ga0316577_10001902 3300031733 Bacteria 10095
69 Ga0307415_100179191 3300032126 Bacteria 1661
70 Ga0373926_0104639 3300035083 Bacteria 1060
71 Ga0316582_0000597 3300036647 Bacteria 13989
72 Ga0316584_0008612 3300036712 Bacteria 7032
73 Ga0316584_0033067 3300036712 Bacteria 3828
74 Ga0436364_0296067 3300037853 Bacteria 138817
75 Ga0436364_0457374 3300037853 Bacteria 22399
76 Ga0436364_1000162 3300037853 Bacteria 14750
77 Ga0436364_1100515 3300037853 Bacteria 4271
78 Ga0436364_1391144 3300037853 Bacteria 6197
79 Ga0436365_0149615 3300039437 Bacteria 33473
80 Ga0436365_0193951 3300039437 Bacteria 2291
81 Ga0436365_0775855 3300039437 Bacteria 20670
82 Ga0436365_0892314 3300039437 Bacteria 56989
83 Ga0436365_1083994 3300039437 Bacteria 225582
84 Ga0436365_1403373 3300039437 Bacteria 3121
85 Ga0436365_1724903 3300039437 Bacteria 10719
86 Ga0436362_1300112 3300039453 Bacteria 63878
87 Ga0439461_0002277 3300041410 Bacteria 3047
88 Ga0439466_0001397 3300041411 Bacteria 9419
89 Ga0439465_0007798 3300041413 Bacteria 3394
90 Ga0439431_0004604 3300041997 Bacteria 3032
91 Ga0439445_0001555 3300042004 Bacteria 4991
92 Ga0439452_009849 3300042010 Bacteria 2804
93 Ga0439434_0022644 3300042435 Bacteria 1888
94 Ga0466966_0009530 3300044684 Bacteria 6429
95 Ga0466966_0037148 3300044684 Bacteria 3142
96 Ga0466961_0028124 3300044693 Bacteria 3615
97 Ga0466963_0025388 3300044694 Bacteria 3778
98 Ga0466963_0082600 3300044694 Bacteria 2178
99 Ga0466971_0003664 3300044719 Bacteria 6571
100 Ga0466971_0047962 3300044719 Bacteria 1920
101 Ga0466971_0087335 3300044719 Bacteria 1426
102 Ga0466968_0001010 3300044735 Bacteria 9914
103 Ga0466970_0040350 3300044765 Bacteria 2479
104 Ga0466957_0031847 3300044842 Bacteria 3154
105 Ga0466960_0005499 3300044901 Bacteria 5023
106 Ga0466959_0005899 3300045049 Bacteria 8436
107 Ga0466958_0011556 3300045836 Bacteria 4974
108 Ga0466958_0013552 3300045836 Bacteria 4643
109 Ga0466958_0024609 3300045836 Bacteria 3543
110 Ga0466958_0043661 3300045836 Bacteria 2700
111 Ga0466967_0000930 3300045976 Bacteria 15773
112 Ga0466967_0009805 3300045976 Bacteria 7142
113 Ga0466967_0335409 3300045976 Bacteria 1461
114 Ga0495653_0135829 3300046463 Bacteria 1735
115 Ga0495648_0002246 3300046524 Bacteria 18048
116 Ga0495654_0073648 3300046530 Bacteria 1615
117 Ga0495672_0004317 3300047320 Bacteria 11709
118 Ga0495673_0000909 3300047469 Bacteria 27065
119 Ga0496100_0019035 3300048903 Bacteria 4088
120 Ga0496104_0105965 3300048907 Bacteria 2694
121 Ga0496105_0170213 3300048908 Bacteria 1786
122 Ga0496108_0000230 3300048911 Bacteria 50141
123 Ga0496108_0100072 3300048911 Bacteria 2472
124 Ga0496109_0001308 3300048912 Bacteria 20550
125 Ga0496109_0104075 3300048912 Bacteria 2635
126 Ga0496110_0188504 3300048913 Bacteria 1873
127 Ga0496114_0169392 3300048917 Bacteria 1903
128 Ga0496117_0024020 3300048920 Bacteria 4837
129 Ga0496118_0006562 3300048921 Bacteria 12723
130 Ga0496126_0006663 3300048929 Bacteria 12845
131 Ga0501034_0147337 3300049571 Bacteria 2331
132 Ga0501044_0342550 3300049823 Bacteria 1416
133 nmdc:mga03n38_8738_c1 3300050490 Bacteria 3652
134 nmdc:mga00v17_10658_c1 3300050491 Bacteria 5027
135 nmdc:mga06z11_4736_c1 3300050494 Bacteria 5379
136 nmdc:mga07m45_22153_c1 3300050496 Bacteria 3468
137 nmdc:mga06r32_25_c5 3300050510 Bacteria 17189
138 nmdc:mga0rr50_428572_c1 3300050513 Bacteria 1119
139 Ga0495619_0038781 3300053085 Bacteria 3108
140 Ga0500643_001688 3300053087 Bacteria 12280
141 Ga0466962_0016417 3300061719 Bacteria 3571

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035083 Ga0373926_0104639 Ga0373926_0104639_14_952 307
2 3300039453 Ga0436362_1300112 Ga0436362_1300112_21851_22810 319
3 3300046463 Ga0495653_0135829 Ga0495653_0135829_20_1015 331
4 3300021358 Ga0213873_10000055 Ga0213873_1000005522 348
5 3300046530 Ga0495654_0073648 Ga0495654_0073648_36_1082 348
6 3300047320 Ga0495672_0004317 Ga0495672_0004317_10610_11656 348
7 3300005366 Ga0070659_100000118 Ga0070659_10000011846 349
8 3300025932 Ga0207690_10000437 Ga0207690_1000043714 349
9 3300050513 nmdc:mga0rr50_428572_c1 nmdc:mga0rr50_428572_c1_25_1092 355
10 3300044765 Ga0466970_0040350 Ga0466970_0040350_276_1355 359
11 3300013105 Ga0157369_10080875 Ga0157369_100808753 371
12 3300044684 Ga0466966_0037148 Ga0466966_0037148_439_1689 371
13 3300044735 Ga0466968_0001010 Ga0466968_0001010_143_1258 371
14 3300045836 Ga0466958_0024609 Ga0466958_0024609_1258_2508 371
15 3300005327 Ga0070658_10006993 Ga0070658_100069934 372
16 3300005345 Ga0070692_10017335 Ga0070692_100173353 372
17 3300005366 Ga0070659_100072329 Ga0070659_1000723291 372
18 3300013105 Ga0157369_10001431 Ga0157369_1000143127 372
19 3300013105 Ga0157369_10044550 Ga0157369_100445503 372
20 3300025909 Ga0207705_10005849 Ga0207705_100058495 372
21 3300025917 Ga0207660_10108041 Ga0207660_101080412 372
22 3300025932 Ga0207690_10007253 Ga0207690_100072532 372
23 3300041410 Ga0439461_0002277 Ga0439461_0002277_1077_2240 372
24 3300041411 Ga0439466_0001397 Ga0439466_0001397_5164_6327 372
25 3300041413 Ga0439465_0007798 Ga0439465_0007798_1649_2812 372
26 3300041997 Ga0439431_0004604 Ga0439431_0004604_394_1557 372
27 3300042004 Ga0439445_0001555 Ga0439445_0001555_3140_4303 372
28 3300042435 Ga0439434_0022644 Ga0439434_0022644_570_1733 372
29 3300005435 Ga0070714_100304251 Ga0070714_1003042512 376
30 3300021384 Ga0213876_10013414 Ga0213876_100134143 376
31 3300021384 Ga0213876_10016491 Ga0213876_100164911 376
32 3300025929 Ga0207664_10269572 Ga0207664_102695721 376
33 3300037853 Ga0436364_0457374 Ga0436364_0457374_16357_17553 376
34 3300037853 Ga0436364_1100515 Ga0436364_1100515_3011_4207 376
35 3300039437 Ga0436365_0149615 Ga0436365_0149615_13501_14697 376
36 3300039437 Ga0436365_1724903 Ga0436365_1724903_4337_5533 376
37 3300053085 Ga0495619_0038781 Ga0495619_0038781_1882_3036 377
38 3300031727 Ga0316576_10000546 Ga0316576_1000054614 378
39 3300031728 Ga0316578_10114490 Ga0316578_101144902 378
40 3300031733 Ga0316577_10001902 Ga0316577_100019026 378
41 3300036647 Ga0316582_0000597 Ga0316582_0000597_1643_2863 378
42 3300036712 Ga0316584_0008612 Ga0316584_0008612_864_2084 378
43 3300036712 Ga0316584_0033067 Ga0316584_0033067_188_1405 378
44 iso_pu_bacteria 2932398195 2932399444 378
45 3300005440 Ga0070705_100026413 Ga0070705_1000264134 379
46 3300005444 Ga0070694_100025181 Ga0070694_1000251812 379
47 3300005468 Ga0070707_100245374 Ga0070707_1002453741 379
48 3300005546 Ga0070696_100014372 Ga0070696_1000143725 379
49 3300005549 Ga0070704_100101598 Ga0070704_1001015982 379
50 3300006847 Ga0075431_100102190 Ga0075431_1001021902 379
51 3300021388 Ga0213875_10000111 Ga0213875_1000011175 379
52 3300037853 Ga0436364_0296067 Ga0436364_0296067_12336_13502 379
53 3300039437 Ga0436365_1403373 Ga0436365_1403373_1261_2445 379
54 3300042010 Ga0439452_009849 Ga0439452_009849_84_1277 379
55 3300044684 Ga0466966_0009530 Ga0466966_0009530_1169_2311 379
56 3300044694 Ga0466963_0025388 Ga0466963_0025388_99_1241 379
57 3300044719 Ga0466971_0003664 Ga0466971_0003664_65_1207 379
58 3300044719 Ga0466971_0087335 Ga0466971_0087335_37_1242 379
59 3300045049 Ga0466959_0005899 Ga0466959_0005899_76_1218 379
60 3300045836 Ga0466958_0011556 Ga0466958_0011556_2538_3680 379
61 3300045976 Ga0466967_0009805 Ga0466967_0009805_3167_4321 379
62 3300048911 Ga0496108_0100072 Ga0496108_0100072_618_1793 379
63 3300048912 Ga0496109_0104075 Ga0496109_0104075_898_2073 379
64 3300048917 Ga0496114_0169392 Ga0496114_0169392_626_1792 379
65 3300049571 Ga0501034_0147337 Ga0501034_0147337_1098_2261 379
66 3300050510 nmdc:mga06r32_25_c5 nmdc:mga06r32_25_c5_10022_11200 379
67 3300061719 Ga0466962_0016417 Ga0466962_0016417_1421_2563 379
68 iso_pu_bacteria 2738543011 2739238568 379
69 iso_pu_bacteria 2984523437 2984526424 379
70 3300001977 JGI24746J21847_1000480 JGI24746J21847_10004805 382
71 3300001990 JGI24737J22298_10010147 JGI24737J22298_100101471 382
72 3300002073 JGI24745J21846_1001396 JGI24745J21846_10013963 382
73 3300005338 Ga0068868_100113065 Ga0068868_1001130652 382
74 3300005340 Ga0070689_100228880 Ga0070689_1002288802 382
75 3300005341 Ga0070691_10028670 Ga0070691_100286702 382
76 3300005354 Ga0070675_100048038 Ga0070675_1000480383 382
77 3300005367 Ga0070667_100139276 Ga0070667_1001392762 382
78 3300005434 Ga0070709_10113121 Ga0070709_101131212 382
79 3300005437 Ga0070710_10010823 Ga0070710_100108234 382
80 3300005539 Ga0068853_100015629 Ga0068853_1000156294 382
81 3300005548 Ga0070665_100078647 Ga0070665_1000786473 382
82 3300005578 Ga0068854_100220783 Ga0068854_1002207832 382
83 3300005615 Ga0070702_100017223 Ga0070702_1000172234 382
84 3300005618 Ga0068864_100041856 Ga0068864_1000418562 382
85 3300005841 Ga0068863_100100386 Ga0068863_1001003861 382
86 3300005842 Ga0068858_100048776 Ga0068858_1000487762 382
87 3300005843 Ga0068860_100319245 Ga0068860_1003192452 382
88 3300006038 Ga0075365_10014494 Ga0075365_100144942 382
89 3300006042 Ga0075368_10007848 Ga0075368_100078483 382
90 3300006048 Ga0075363_100013571 Ga0075363_1000135713 382
91 3300006051 Ga0075364_10005916 Ga0075364_100059165 382
92 3300006177 Ga0075362_10056726 Ga0075362_100567262 382
93 3300006353 Ga0075370_10000494 Ga0075370_100004946 382
94 3300006881 Ga0068865_100131411 Ga0068865_1001314112 382
95 3300009101 Ga0105247_10020579 Ga0105247_100205794 382
96 3300009148 Ga0105243_10000243 Ga0105243_1000024310 382
97 3300009176 Ga0105242_10081438 Ga0105242_100814382 382
98 3300011119 Ga0105246_10047295 Ga0105246_100472951 382
99 3300013308 Ga0157375_10389619 Ga0157375_103896191 382
100 3300014326 Ga0157380_10039604 Ga0157380_100396042 382
101 3300014968 Ga0157379_10216612 Ga0157379_102166122 382
102 3300021384 Ga0213876_10001195 Ga0213876_1000119512 382
103 3300021384 Ga0213876_10015880 Ga0213876_100158802 382
104 3300021388 Ga0213875_10011919 Ga0213875_100119193 382
105 3300025901 Ga0207688_10022757 Ga0207688_100227573 382
106 3300025926 Ga0207659_10075567 Ga0207659_100755672 382
107 3300025929 Ga0207664_10073571 Ga0207664_100735713 382
108 3300025935 Ga0207709_10002717 Ga0207709_1000271710 382
109 3300026088 Ga0207641_10126917 Ga0207641_101269172 382
110 3300026095 Ga0207676_10124070 Ga0207676_101240702 382
111 3300028379 Ga0268266_10343491 Ga0268266_103434911 382
112 3300032126 Ga0307415_100179191 Ga0307415_1001791912 382
113 3300037853 Ga0436364_1000162 Ga0436364_1000162_9428_10591 382
114 3300037853 Ga0436364_1391144 Ga0436364_1391144_2834_4006 382
115 3300039437 Ga0436365_0193951 Ga0436365_0193951_80_1243 382
116 3300039437 Ga0436365_0775855 Ga0436365_0775855_12503_13678 382
117 3300039437 Ga0436365_0892314 Ga0436365_0892314_11237_12400 382
118 3300039437 Ga0436365_1083994 Ga0436365_1083994_44471_45634 382
119 3300044693 Ga0466961_0028124 Ga0466961_0028124_1752_2915 382
120 3300044694 Ga0466963_0082600 Ga0466963_0082600_714_1877 382
121 3300044719 Ga0466971_0047962 Ga0466971_0047962_126_1325 382
122 3300044842 Ga0466957_0031847 Ga0466957_0031847_1116_2279 382
123 3300044901 Ga0466960_0005499 Ga0466960_0005499_1478_2641 382
124 3300045836 Ga0466958_0013552 Ga0466958_0013552_2237_3400 382
125 3300045836 Ga0466958_0043661 Ga0466958_0043661_1105_2268 382
126 3300045976 Ga0466967_0000930 Ga0466967_0000930_9346_10509 382
127 3300045976 Ga0466967_0335409 Ga0466967_0335409_66_1229 382
128 3300046524 Ga0495648_0002246 Ga0495648_0002246_16272_17435 382
129 3300047469 Ga0495673_0000909 Ga0495673_0000909_21356_22519 382
130 3300048903 Ga0496100_0019035 Ga0496100_0019035_2670_3833 382
131 3300048907 Ga0496104_0105965 Ga0496104_0105965_388_1551 382
132 3300048908 Ga0496105_0170213 Ga0496105_0170213_435_1598 382
133 3300048911 Ga0496108_0000230 Ga0496108_0000230_14217_15380 382
134 3300048912 Ga0496109_0001308 Ga0496109_0001308_5150_6313 382
135 3300048913 Ga0496110_0188504 Ga0496110_0188504_598_1761 382
136 3300048920 Ga0496117_0024020 Ga0496117_0024020_32_1195 382
137 3300048921 Ga0496118_0006562 Ga0496118_0006562_8222_9385 382
138 3300048929 Ga0496126_0006663 Ga0496126_0006663_7970_9133 382
139 3300049823 Ga0501044_0342550 Ga0501044_0342550_91_1254 382
140 3300050490 nmdc:mga03n38_8738_c1 nmdc:mga03n38_8738_c1_1136_2299 382
141 3300050491 nmdc:mga00v17_10658_c1 nmdc:mga00v17_10658_c1_2046_3209 382
142 3300050494 nmdc:mga06z11_4736_c1 nmdc:mga06z11_4736_c1_2071_3234 382
143 3300050496 nmdc:mga07m45_22153_c1 nmdc:mga07m45_22153_c1_811_1974 382
144 3300053087 Ga0500643_001688 Ga0500643_001688_3130_4293 382
145 iso_pu_bacteria 2643221715 2644634431 382
146 iso_pu_bacteria 2738543034 2739366144 382
147 iso_pu_bacteria 2842134933 2842138871 382
148 iso_pu_bacteria 2842888712 2842890894 382
149 iso_pu_bacteria 2889300758 2889303002 382
150 iso_pu_bacteria 2902810491 2902816847 382
151 iso_pu_bacteria 2939743619 2939746120 382
152 iso_pu_bacteria 2974315732 2974318212 382

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13439

Glyco_transf_4

Glycosyltransferase Family 4

46

208

0.87

PF00534

Glycos_transf_1

Glycosyl transferases group 1

221

395

0.85

PF13524

Glyco_trans_1_2

Glycosyl transferases group 1

245

411

0.84

PF20706

GT4-conflict

Family 4 Glycosyltransferase in conflict systems

115

409

0.84

PF08323

Glyco_transf_5

Starch synthase catalytic domain

89

194

0.8

PF13579

Glyco_trans_4_4

Glycosyl transferase 4-like domain

47

203

0.8

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

230

381

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tvp-assembly1.cif.gz_A structure of mycobacterium smegmatis alpha-maltose-1-phosphate synthase glgm 0.9447 2 382
6tvp-assembly1.cif.gz_A structure of mycobacterium smegmatis alpha-maltose-1-phosphate synthase glgm 0.9329 2 382
6tvp-assembly1.cif.gz_B structure of mycobacterium smegmatis alpha-maltose-1-phosphate synthase glgm 0.8745 2 382
6tvp-assembly1.cif.gz_B structure of mycobacterium smegmatis alpha-maltose-1-phosphate synthase glgm 0.8703 2 382
5d01-assembly1.cif.gz_B crystal structure of bsha from b. subtilis complexed with n-acetylglucosaminyl-malate 0.8416 2 380
ID Description Score Start End Superfamily
af_P9WMZ1_187_386_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9981 183 380 3.40.50.2000
af_P9WMZ1_187_386_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9832 183 380 3.40.50.2000
af_P9WMZ1_1_186_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9727 3 180 3.40.50.2000
af_P9WMZ1_1_186_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9267 3 180 3.40.50.2000
af_Q58577_179_333_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9185 195 362 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A6B3ETM7-F1-model_v4 D-inositol 3-phosphate glycosyltransferase 0.9983 269 366 GO:0016757
AF-A0A7Y4LH41-F1-model_v4 Glycogen synthase (EC 2.4.1.21) 0.9887 2 380 GO:0009250
GO:0016758
AF-A0A7K0MIN9-F1-model_v4 Glycogen synthase 0.9834 96 382 GO:0009103
GO:0009250
GO:0016757
GO:0045226
AF-A0A0C5BEH5-F1-model_v4 Glycosyl transferase family 1 0.9801 2 380 GO:0009250
GO:0016757
AF-A0A7Y4LH41-F1-model_v4 Glycogen synthase (EC 2.4.1.21) 0.9785 2 380 GO:0009250
GO:0016758

Feature Viewer

pLDDT pTM Quality
92.8 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map