F214332

General Info

Members Datasets Scaffolds Average Seq Length
152 39 151 181

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10099417|Ga0163162_100994177
Length 186
Sequence MDMSETIAAKSDQQNFDDYLVGPRTVSIAGVTKGSADQPVNIELVEYPGKPFKPNKSMRRVLVMAWGADSTAYVGRRMTLFGNPEVVYGGKAVGGIEISHLSHIEKPLTVALTATRGKRKNFTVTPLAAPAPARDWLAEAKYAGGDIDLLRALYKAAASAGAAPDILAKFQGLATNAPPATPADES

Samples

Sample ID Description Type Environment
1 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
5 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
6 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
7 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
8 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
9 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
10 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
11 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
12 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
13 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
14 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
15 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
19 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
20 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
21 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
22 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
23 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
24 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
25 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
26 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
27 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
28 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
29 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
30 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
31 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
32 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
33 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
34 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
35 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
36 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
37 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
38 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
39 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0.66
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10006642 3300005288 Bacteria 3497
2 Ga0065714_10007860 3300005288 Viruses 3327
3 Ga0065714_10016241 3300005288 Bacteria 1565
4 Ga0065714_10064520 3300005288 Bacteria 42799
5 Ga0065714_10065238 3300005288 Viruses 11521
6 Ga0065714_10067483 3300005288 Viruses 5457
7 Ga0065714_10068293 3300005288 Viruses 4835
8 Ga0065714_10070157 3300005288 Viruses 3952
9 Ga0065714_10080291 3300005288 Bacteria 2450
10 Ga0065714_10085235 3300005288 Bacteria 2158
11 Ga0065714_10087588 3300005288 Bacteria 2052
12 Ga0065714_10089642 3300005288 Unclassified 1972
13 Ga0065714_10092368 3300005288 Bacteria 1801
14 Ga0065714_10097733 3300005288 Viruses 1728
15 Ga0065714_10107734 3300005288 Viruses 1526
16 Ga0065714_10111189 3300005288 Viruses 1474
17 Ga0065712_10070725 3300005290 Bacteria 5760
18 Ga0065712_10079854 3300005290 Viruses 3172
19 Ga0065712_10128201 3300005290 Bacteria 1582
20 Ga0065712_10380878 3300005290 Bacteria 746
21 Ga0070705_100020442 3300005440 Bacteria 3504
22 Ga0075432_10000792 3300006058 Bacteria 9844
23 Ga0105243_10010779 3300009148 Bacteria 6919
24 Ga0157373_10029492 3300013100 Bacteria 3951
25 Ga0157373_10037055 3300013100 Viruses 3499
26 Ga0157373_10150038 3300013100 Unclassified 1640
27 Ga0157373_10581404 3300013100 Viruses 814
28 Ga0157371_10005475 3300013102 Bacteria 10700
29 Ga0157371_10044315 3300013102 Viruses 3168
30 Ga0157371_10112146 3300013102 Viruses 1936
31 Ga0157371_10113595 3300013102 Bacteria 1923
32 Ga0157371_10129007 3300013102 Bacteria 1799
33 Ga0157371_10130156 3300013102 Unclassified 1790
34 Ga0157371_10161700 3300013102 Bacteria 1599
35 Ga0157371_10255650 3300013102 Viruses 1262
36 Ga0157370_10018496 3300013104 Bacteria 7004
37 Ga0157370_10058726 3300013104 Bacteria 3656
38 Ga0157370_10059444 3300013104 Bacteria 3632
39 Ga0157370_11079249 3300013104 Viruses 726
40 Ga0157369_10000771 3300013105 Bacteria 41450
41 Ga0157369_10002591 3300013105 Bacteria 21620
42 Ga0157374_10557906 3300013296 Bacteria 1153
43 Ga0163162_10006728 3300013306 Bacteria 11151
44 Ga0163162_10021206 3300013306 Bacteria 6393
45 Ga0163162_10028203 3300013306 Bacteria 5553
46 Ga0163162_10038259 3300013306 Bacteria 4788
47 Ga0163162_10050174 3300013306 Viruses 4185
48 Ga0163162_10050298 3300013306 Bacteria 4179
49 Ga0163162_10099417 3300013306 Bacteria 3000
50 Ga0163162_10119520 3300013306 Bacteria 2738
51 Ga0163162_10151817 3300013306 Bacteria 2435
52 Ga0163162_10222985 3300013306 Bacteria 2015
53 Ga0163162_10225531 3300013306 Bacteria 2004
54 Ga0163162_10238855 3300013306 Viruses 1948
55 Ga0163162_10260750 3300013306 Bacteria 1865
56 Ga0163162_10263409 3300013306 Viruses 1855
57 Ga0163162_10318240 3300013306 Bacteria 1688
58 Ga0163162_10406615 3300013306 Bacteria 1494
59 Ga0163162_10418841 3300013306 Viruses 1472
60 Ga0163162_10432489 3300013306 Bacteria 1448
61 Ga0163162_10597792 3300013306 Viruses 1230
62 Ga0163162_10693674 3300013306 Bacteria 1140
63 Ga0163162_10839090 3300013306 Bacteria 1035
64 Ga0163162_10966476 3300013306 Bacteria 962
65 Ga0163162_11259346 3300013306 Viruses 840
66 Ga0163162_11296292 3300013306 Unclassified 827
67 Ga0163162_11318340 3300013306 Viruses 820
68 Ga0163162_11741908 3300013306 Bacteria 712
69 Ga0157375_10002965 3300013308 Bacteria 14738
70 Ga0157375_10005933 3300013308 Bacteria 10647
71 Ga0157375_10012412 3300013308 Bacteria 7557
72 Ga0157375_10015548 3300013308 Bacteria 6815
73 Ga0157375_10016763 3300013308 Bacteria 6594
74 Ga0157375_10031251 3300013308 Bacteria 5030
75 Ga0157375_10040203 3300013308 Viruses 4506
76 Ga0157375_10052215 3300013308 Viruses 4018
77 Ga0157375_10056736 3300013308 Viruses 3869
78 Ga0157375_10116759 3300013308 Bacteria 2773
79 Ga0157375_10149882 3300013308 Bacteria 2467
80 Ga0157375_10151037 3300013308 Unclassified 2458
81 Ga0157375_10172590 3300013308 Viruses 2310
82 Ga0157375_10229664 3300013308 Unclassified 2015
83 Ga0157375_10237867 3300013308 Viruses 1980
84 Ga0157375_10262680 3300013308 Viruses 1888
85 Ga0157375_10316771 3300013308 Bacteria 1724
86 Ga0157375_10327433 3300013308 Bacteria 1697
87 Ga0157375_10338913 3300013308 Viruses 1669
88 Ga0157375_10440606 3300013308 Bacteria 1468
89 Ga0157375_10497722 3300013308 Bacteria 1383
90 Ga0157375_10644265 3300013308 Bacteria 1216
91 Ga0157375_10804874 3300013308 Unclassified 1088
92 Ga0157375_10811042 3300013308 Bacteria 1084
93 Ga0157375_10863521 3300013308 Unclassified 1051
94 Ga0157375_10908716 3300013308 Bacteria 1024
95 Ga0157375_10938234 3300013308 Unclassified 1008
96 Ga0157375_10941053 3300013308 Bacteria 1006
97 Ga0157375_11064030 3300013308 Bacteria 946
98 Ga0157375_11340940 3300013308 Viruses 842
99 Ga0157375_11359268 3300013308 Bacteria 836
100 Ga0157375_11419097 3300013308 Unclassified 818
101 Ga0163161_10042156 3300017792 Viruses 3282
102 Ga0163161_10138757 3300017792 Bacteria 1839
103 Ga0163161_10189512 3300017792 Bacteria 1580
104 Ga0163161_10447367 3300017792 Bacteria 1044
105 Ga0163161_10806202 3300017792 Unclassified 789
106 Ga0207655_1033730 3300025728 Bacteria 2315
107 Ga0207681_10001140 3300025923 Bacteria 17145
108 Ga0207709_10006136 3300025935 Bacteria 6771
109 Ga0207428_10005125 3300027907 Bacteria 12282
110 Ga0307408_100001080 3300031548 Bacteria 20866
111 Ga0307408_100010851 3300031548 Bacteria 6011
112 Ga0307408_100051940 3300031548 Bacteria 2955
113 Ga0307408_100985459 3300031548 Unclassified 776
114 Ga0307405_10014373 3300031731 Bacteria 4255
115 Ga0307405_10030645 3300031731 Viruses 3156
116 Ga0307413_10011042 3300031824 Viruses 4417
117 Ga0307413_10016897 3300031824 Bacteria 3786
118 Ga0307413_10129965 3300031824 Viruses 1722
119 Ga0307413_10718309 3300031824 Unclassified 832
120 Ga0307410_10006384 3300031852 Bacteria 6358
121 Ga0307410_10124382 3300031852 Bacteria 1886
122 Ga0307410_10435683 3300031852 Unclassified 1066
123 Ga0307410_10457100 3300031852 Bacteria 1043
124 Ga0307407_10019231 3300031903 Bacteria 3473
125 Ga0307407_10274758 3300031903 Bacteria 1164
126 Ga0307412_10005638 3300031911 Bacteria 7029
127 Ga0307412_10020832 3300031911 Viruses 3996
128 Ga0307412_10294869 3300031911 Bacteria 1279
129 Ga0307409_100033376 3300031995 Bacteria 3745
130 Ga0307416_100534529 3300032002 Bacteria 1243
131 Ga0307416_100726061 3300032002 Unclassified 1084
132 Ga0307416_101263781 3300032002 Bacteria 844
133 Ga0307414_10040764 3300032004 Bacteria 3139
134 Ga0307414_10174715 3300032004 Unclassified 1721
135 Ga0307414_10722635 3300032004 Unclassified 903
136 Ga0307414_10802571 3300032004 Unclassified 858
137 Ga0307411_10000082 3300032005 Viruses 29336
138 Ga0307411_10290361 3300032005 Bacteria 1306
139 Ga0495631_0042267 3300046518 Viruses 2015
140 Ga0495643_0015726 3300046522 Bacteria 4462
141 Ga0495642_0000377 3300046528 Bacteria 24171
142 Ga0495642_0003678 3300046528 Bacteria 6018
143 Ga0495642_0164453 3300046528 Unclassified 963
144 Ga0495609_0004626 3300046538 Bacteria 7467
145 Ga0495656_0022029 3300046615 Bacteria 2490
146 Ga0495668_0003026 3300046616 Bacteria 13098
147 Ga0495670_0037508 3300046691 Bacteria 2416
148 Ga0495589_0030652 3300046794 Bacteria 2708
149 Ga0495581_0066286 3300047315 Viruses 2088
150 Ga0495636_0064685 3300047318 Bacteria 1552
151 Ga0495685_025767 3300047447 Viruses 2024

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046615 Ga0495656_0022029 Ga0495656_0022029_200_739 161
2 3300031824 Ga0307413_10011042 Ga0307413_100110423 162
3 3300031852 Ga0307410_10006384 Ga0307410_100063843 162
4 3300032004 Ga0307414_10174715 Ga0307414_101747153 162
5 3300005288 Ga0065714_10068293 Ga0065714_100682934 164
6 3300013308 Ga0157375_10015548 Ga0157375_1001554815 164
7 3300013308 Ga0157375_10040203 Ga0157375_1004020311 165
8 3300046518 Ga0495631_0042267 Ga0495631_0042267_259_801 165
9 3300046522 Ga0495643_0015726 Ga0495643_0015726_578_1120 165
10 3300046528 Ga0495642_0000377 Ga0495642_0000377_20256_20798 165
11 3300046616 Ga0495668_0003026 Ga0495668_0003026_11428_11970 165
12 3300047318 Ga0495636_0064685 Ga0495636_0064685_332_874 165
13 3300005288 Ga0065714_10092368 Ga0065714_100923682 166
14 3300013306 Ga0163162_11741908 Ga0163162_117419081 166
15 3300046691 Ga0495670_0037508 Ga0495670_0037508_42_581 166
16 3300013306 Ga0163162_10021206 Ga0163162_100212067 168
17 3300013102 Ga0157371_10255650 Ga0157371_102556502 169
18 3300013308 Ga0157375_10440606 Ga0157375_104406063 169
19 3300013104 Ga0157370_10059444 Ga0157370_100594445 170
20 3300013306 Ga0163162_10693674 Ga0163162_106936742 170
21 3300031548 Ga0307408_100051940 Ga0307408_1000519402 170
22 3300031852 Ga0307410_10124382 Ga0307410_101243822 170
23 3300031903 Ga0307407_10274758 Ga0307407_102747582 170
24 3300031995 Ga0307409_100033376 Ga0307409_1000333763 170
25 3300032004 Ga0307414_10722635 Ga0307414_107226352 170
26 3300032004 Ga0307414_10802571 Ga0307414_108025712 170
27 3300032005 Ga0307411_10000082 Ga0307411_1000008235 170
28 3300031548 Ga0307408_100001080 Ga0307408_1000010806 171
29 3300031824 Ga0307413_10129965 Ga0307413_101299652 171
30 3300031852 Ga0307410_10435683 Ga0307410_104356832 171
31 3300032002 Ga0307416_100726061 Ga0307416_1007260613 171
32 3300013308 Ga0157375_10644265 Ga0157375_106442652 172
33 3300005288 Ga0065714_10064520 Ga0065714_1006452066 173
34 3300005288 Ga0065714_10089642 Ga0065714_100896422 174
35 3300006058 Ga0075432_10000792 Ga0075432_100007922 174
36 3300013104 Ga0157370_10018496 Ga0157370_100184967 174
37 3300013105 Ga0157369_10000771 Ga0157369_1000077162 174
38 3300027907 Ga0207428_10005125 Ga0207428_1000512514 174
39 3300032002 Ga0307416_100534529 Ga0307416_1005345292 174
40 iso_pu_bacteria 2984551494 2984555208 174
41 3300005288 Ga0065714_10067483 Ga0065714_100674832 175
42 3300005288 Ga0065714_10087588 Ga0065714_100875885 175
43 3300013306 Ga0163162_10151817 Ga0163162_101518174 175
44 3300013306 Ga0163162_10225531 Ga0163162_102255312 175
45 3300013308 Ga0157375_11064030 Ga0157375_110640301 175
46 3300031852 Ga0307410_10457100 Ga0307410_104571001 175
47 3300013102 Ga0157371_10005475 Ga0157371_1000547512 176
48 3300013102 Ga0157371_10044315 Ga0157371_100443156 176
49 3300013100 Ga0157373_10150038 Ga0157373_101500382 177
50 3300046528 Ga0495642_0003678 Ga0495642_0003678_352_894 177
51 3300046794 Ga0495589_0030652 Ga0495589_0030652_180_722 177
52 3300047447 Ga0495685_025767 Ga0495685_025767_107_646 177
53 3300013102 Ga0157371_10161700 Ga0157371_101617003 178
54 3300013296 Ga0157374_10557906 Ga0157374_105579063 178
55 3300013306 Ga0163162_10028203 Ga0163162_100282038 178
56 3300013306 Ga0163162_10050174 Ga0163162_1005017410 178
57 3300013306 Ga0163162_10839090 Ga0163162_108390901 178
58 3300013308 Ga0157375_10002965 Ga0157375_1000296522 178
59 3300013308 Ga0157375_10056736 Ga0157375_100567368 178
60 3300031824 Ga0307413_10718309 Ga0307413_107183092 178
61 3300031911 Ga0307412_10005638 Ga0307412_100056385 178
62 3300005288 Ga0065714_10065238 Ga0065714_1006523816 179
63 3300013100 Ga0157373_10037055 Ga0157373_100370553 179
64 3300013104 Ga0157370_10058726 Ga0157370_100587267 179
65 3300013308 Ga0157375_10016763 Ga0157375_1001676314 179
66 3300013308 Ga0157375_11419097 Ga0157375_114190972 179
67 3300031548 Ga0307408_100985459 Ga0307408_1009854591 179
68 3300005288 Ga0065714_10070157 Ga0065714_100701574 180
69 3300005288 Ga0065714_10107734 Ga0065714_101077342 180
70 3300013105 Ga0157369_10002591 Ga0157369_1000259130 180
71 3300013306 Ga0163162_10006728 Ga0163162_1000672813 180
72 3300013308 Ga0157375_10005933 Ga0157375_1000593323 180
73 3300013308 Ga0157375_10012412 Ga0157375_1001241213 180
74 3300013308 Ga0157375_10031251 Ga0157375_1003125115 180
75 3300013308 Ga0157375_10262680 Ga0157375_102626801 180
76 3300017792 Ga0163161_10189512 Ga0163161_101895123 180
77 3300031731 Ga0307405_10030645 Ga0307405_100306455 180
78 3300031911 Ga0307412_10294869 Ga0307412_102948693 180
79 3300032002 Ga0307416_101263781 Ga0307416_1012637811 180
80 3300046528 Ga0495642_0164453 Ga0495642_0164453_258_803 180
81 3300005288 Ga0065714_10085235 Ga0065714_100852352 181
82 3300005290 Ga0065712_10380878 Ga0065712_103808781 181
83 3300005440 Ga0070705_100020442 Ga0070705_1000204426 181
84 3300009148 Ga0105243_10010779 Ga0105243_100107792 181
85 3300013306 Ga0163162_10038259 Ga0163162_1003825911 181
86 3300013306 Ga0163162_10119520 Ga0163162_101195209 181
87 3300013306 Ga0163162_10263409 Ga0163162_102634093 181
88 3300013306 Ga0163162_11296292 Ga0163162_112962922 181
89 3300013308 Ga0157375_10149882 Ga0157375_101498826 181
90 3300013308 Ga0157375_10229664 Ga0157375_102296644 181
91 3300013308 Ga0157375_10316771 Ga0157375_103167713 181
92 3300017792 Ga0163161_10806202 Ga0163161_108062021 181
93 3300025728 Ga0207655_1033730 Ga0207655_10337303 181
94 3300025923 Ga0207681_10001140 Ga0207681_1000114034 181
95 3300025935 Ga0207709_10006136 Ga0207709_100061362 181
96 3300031548 Ga0307408_100010851 Ga0307408_10001085111 181
97 3300031731 Ga0307405_10014373 Ga0307405_100143736 181
98 3300031824 Ga0307413_10016897 Ga0307413_100168974 181
99 3300031903 Ga0307407_10019231 Ga0307407_100192318 181
100 3300031911 Ga0307412_10020832 Ga0307412_100208321 181
101 3300032004 Ga0307414_10040764 Ga0307414_100407644 181
102 3300032005 Ga0307411_10290361 Ga0307411_102903612 181
103 3300046538 Ga0495609_0004626 Ga0495609_0004626_232_795 181
104 3300005288 Ga0065714_10007860 Ga0065714_100078602 182
105 3300005288 Ga0065714_10016241 Ga0065714_100162412 182
106 3300005288 Ga0065714_10080291 Ga0065714_100802913 182
107 3300005288 Ga0065714_10097733 Ga0065714_100977333 182
108 3300005288 Ga0065714_10111189 Ga0065714_101111892 182
109 3300005290 Ga0065712_10070725 Ga0065712_1007072512 182
110 3300005290 Ga0065712_10079854 Ga0065712_1007985410 182
111 3300005290 Ga0065712_10128201 Ga0065712_101282011 182
112 3300013100 Ga0157373_10581404 Ga0157373_105814042 182
113 3300013102 Ga0157371_10112146 Ga0157371_101121464 182
114 3300013102 Ga0157371_10130156 Ga0157371_101301562 182
115 3300013104 Ga0157370_11079249 Ga0157370_110792491 182
116 3300013306 Ga0163162_10050298 Ga0163162_100502984 182
117 3300013306 Ga0163162_10222985 Ga0163162_102229854 182
118 3300013306 Ga0163162_10238855 Ga0163162_102388555 182
119 3300013306 Ga0163162_10260750 Ga0163162_102607504 182
120 3300013306 Ga0163162_10318240 Ga0163162_103182402 182
121 3300013306 Ga0163162_10406615 Ga0163162_104066154 182
122 3300013306 Ga0163162_10418841 Ga0163162_104188411 182
123 3300013306 Ga0163162_10432489 Ga0163162_104324891 182
124 3300013306 Ga0163162_10597792 Ga0163162_105977922 182
125 3300013306 Ga0163162_10966476 Ga0163162_109664762 182
126 3300013306 Ga0163162_11259346 Ga0163162_112593462 182
127 3300013308 Ga0157375_10052215 Ga0157375_100522158 182
128 3300013308 Ga0157375_10151037 Ga0157375_101510373 182
129 3300013308 Ga0157375_10237867 Ga0157375_102378675 182
130 3300013308 Ga0157375_10327433 Ga0157375_103274333 182
131 3300013308 Ga0157375_10338913 Ga0157375_103389132 182
132 3300013308 Ga0157375_10497722 Ga0157375_104977222 182
133 3300013308 Ga0157375_10804874 Ga0157375_108048743 182
134 3300013308 Ga0157375_10811042 Ga0157375_108110422 182
135 3300013308 Ga0157375_10863521 Ga0157375_108635211 182
136 3300013308 Ga0157375_10908716 Ga0157375_109087162 182
137 3300013308 Ga0157375_10938234 Ga0157375_109382342 182
138 3300013308 Ga0157375_10941053 Ga0157375_109410533 182
139 3300013308 Ga0157375_11340940 Ga0157375_113409402 182
140 3300013308 Ga0157375_11359268 Ga0157375_113592681 182
141 3300017792 Ga0163161_10042156 Ga0163161_100421568 182
142 3300017792 Ga0163161_10447367 Ga0163161_104473673 182
143 3300047315 Ga0495581_0066286 Ga0495581_0066286_1196_1744 182
144 3300013306 Ga0163162_10099417 Ga0163162_100994177 183
145 3300013308 Ga0157375_10116759 Ga0157375_101167595 183
146 3300013308 Ga0157375_10172590 Ga0157375_101725902 183
147 3300005288 Ga0065714_10006642 Ga0065714_100066429 184
148 3300013100 Ga0157373_10029492 Ga0157373_100294922 184
149 3300013102 Ga0157371_10113595 Ga0157371_101135951 184
150 3300013102 Ga0157371_10129007 Ga0157371_101290073 184
151 3300013306 Ga0163162_11318340 Ga0163162_113183402 184
152 3300017792 Ga0163161_10138757 Ga0163161_101387573 184

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mxz-assembly1.cif.gz_A crystal structure of tubulin folding cofactor a from arabidopsis thaliana 0.7557 136 182
2ahm-assembly1.cif.gz_G crystal structure of sars-cov super complex of non-structural proteins: the hexadecamer 0.7393 138 183
3ub0-assembly2.cif.gz_D crystal structure of the nonstructural protein 7 and 8 complex of feline coronavirus 0.7206 131 183
3ub0-assembly1.cif.gz_A crystal structure of the nonstructural protein 7 and 8 complex of feline coronavirus 0.6816 131 183
6jdk-assembly2.cif.gz_B crystal structure of baeyer-villiger monooxygenase from parvibaculum lavamentivorans 0.6463 26 53
ID Description Score Start End Superfamily
af_P05511_299_561_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8604 143 174 3.20.20.210
af_A4IBU6_200_296_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.853 146 176 1.25.40.10
af_P07814_749_805_1.10.287.10 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.7843 135 183 1.10.287.10
af_Q9V9U7_1_108_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7757 134 182 1.20.58.90
af_Q9Y703_1_113_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.771 136 182 1.20.58.90
ID Description Score Start End GO Terms
AF-A0A652KHQ3-F1-model_v4 Phage recombination protein Bet 0.9812 136 180 GO:0003677
GO:0006310
AF-A0A7S8MVQ4-F1-model_v4 ERF family protein 0.9655 134 183
AF-A0A6G4WV46-F1-model_v4 Recombinase RecT 0.95 132 177 GO:0003677
GO:0006259
AF-A0A3N4S8G1-F1-model_v4 RecT family protein 0.9387 131 183
AF-A0A1H2CHA2-F1-model_v4 deleted 0.9242 134 177

Feature Viewer

pLDDT pTM Quality
85.74 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map