F213816

General Info

Members Datasets Scaffolds Average Seq Length
152 116 140 273

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100382244|Ga0068855_1003822442
Length 290
Sequence LAELFDQHGPSDPHDRYGSDVLADARAANAARAIPTVDAHPGEVLELPDGFVGAVTRLEKGTVELEDRHGARRVFPLGPGFLVDGKPVVVRAPTAAAPRPGQVRTASGSIAQTSPGEPQRARVARAHRIFVEGRHDGELVEKIWGPDLRAEGIVVEYLDGIDHLDETLRAVQPGPERRIGVLVDHLVPGSKESRIAEQVTSPHVLVVGHPFIDVWQGVKPSRLGLSAWPVIARGTEWKHGVCAALGWPHDDQTDIAAAWQRILGSVRDYHDLEPALLGRVEQLIDFTSTP

Samples

Sample ID Description Type Environment
1 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
2 2643221566 Microbacterium sp. Root166 Isolate Unclassified
3 2643221597 Microbacterium sp. Root180 Isolate Unclassified
4 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
5 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
6 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
7 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
8 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
9 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
10 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
11 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
70 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
71 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
72 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
73 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
74 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
75 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
76 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
77 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
78 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
79 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
80 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
81 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
82 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
83 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
84 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
85 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
86 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
87 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
88 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
89 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
90 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
91 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
92 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
103 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
104 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
106 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
107 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
108 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
109 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
110 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
111 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
112 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
113 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
114 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
115 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
116 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.11
Metatranscriptomes 0
Isolates 7.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.89
Nodule 0
Rhizoplane 7.24
Rhizosphere 73.03
Stem 0
Stem Tuber 0
Unclassified 11.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10007925 3300005327 Bacteria 8552
2 Ga0070658_10173222 3300005327 Bacteria 1813
3 Ga0070666_10105077 3300005335 Bacteria 1950
4 Ga0068868_100201318 3300005338 Bacteria 1660
5 Ga0070660_100014578 3300005339 Bacteria 5669
6 Ga0070659_100000149 3300005366 Bacteria 53509
7 Ga0070667_100015030 3300005367 Bacteria 6395
8 Ga0070714_100217931 3300005435 Bacteria 1753
9 Ga0068853_100034953 3300005539 Bacteria 4267
10 Ga0068853_100083148 3300005539 Bacteria 2804
11 Ga0070672_100030545 3300005543 Bacteria 4049
12 Ga0070665_100078265 3300005548 Bacteria 3313
13 Ga0068855_100005174 3300005563 Bacteria 15907
14 Ga0068855_100027328 3300005563 Bacteria 6826
15 Ga0068855_100261765 3300005563 Bacteria 1926
16 Ga0068855_100261766 3300005563 Bacteria 1926
17 Ga0068855_100382244 3300005563 Bacteria 1546
18 Ga0068857_100160525 3300005577 Bacteria 2040
19 Ga0068856_100015493 3300005614 Bacteria 7368
20 Ga0068856_100142248 3300005614 Bacteria 2406
21 Ga0068852_100007241 3300005616 Bacteria 8092
22 Ga0068852_100045478 3300005616 Bacteria 3734
23 Ga0068864_100033064 3300005618 Bacteria 4396
24 Ga0068851_10000014 3300005834 Bacteria 151675
25 Ga0068863_100057657 3300005841 Bacteria 3675
26 Ga0068858_100000276 3300005842 Bacteria 55258
27 Ga0075365_10008356 3300006038 Bacteria 5869
28 Ga0075365_10088910 3300006038 Bacteria 2102
29 Ga0105240_10002898 3300009093 Bacteria 27065
30 Ga0105240_10823419 3300009093 Bacteria 1004
31 Ga0105245_10023393 3300009098 Bacteria 5423
32 Ga0105247_10009201 3300009101 Bacteria 6008
33 Ga0105243_10042762 3300009148 Bacteria 3548
34 Ga0105241_10003266 3300009174 Bacteria 12064
35 Ga0105248_10000681 3300009177 Bacteria 38440
36 Ga0105248_10193754 3300009177 Bacteria 2290
37 Ga0105237_10016997 3300009545 Bacteria 7549
38 Ga0105237_10336753 3300009545 Bacteria 1513
39 Ga0105238_10032429 3300009551 Bacteria 5316
40 Ga0105238_10075761 3300009551 Bacteria 3356
41 Ga0105239_10062592 3300010375 Bacteria 4084
42 Ga0105239_10437305 3300010375 Bacteria 1483
43 Ga0105239_10893789 3300010375 Bacteria 1019
44 Ga0171462_1001 3300013250 Bacteria 1135406
45 Ga0163163_10227033 3300014325 Bacteria 1916
46 Ga0157379_10008422 3300014968 Bacteria 8964
47 Ga0207656_10000002 3300025321 Bacteria 792178
48 Ga0207655_1009321 3300025728 Bacteria 6110
49 Ga0207705_10180493 3300025909 Bacteria 1593
50 Ga0207654_10000001 3300025911 Bacteria 1816198
51 Ga0207695_10002117 3300025913 Bacteria 30146
52 Ga0207695_10009994 3300025913 Bacteria 11655
53 Ga0207671_10000002 3300025914 Bacteria 1144816
54 Ga0207657_10004316 3300025919 Bacteria 15066
55 Ga0207694_10000274 3300025924 Bacteria 48845
56 Ga0207694_10046649 3300025924 Bacteria 3349
57 Ga0207687_10073997 3300025927 Bacteria 2441
58 Ga0207687_10107625 3300025927 Bacteria 2063
59 Ga0207700_10018485 3300025928 Bacteria 4685
60 Ga0207690_10001692 3300025932 Bacteria 13602
61 Ga0207709_10023134 3300025935 Bacteria 3533
62 Ga0207691_10045133 3300025940 Bacteria 4052
63 Ga0207711_10007361 3300025941 Bacteria 9212
64 Ga0207711_10111125 3300025941 Bacteria 2437
65 Ga0207667_10000272 3300025949 Bacteria 71730
66 Ga0207667_10001177 3300025949 Bacteria 32862
67 Ga0207667_10208414 3300025949 Bacteria 2004
68 Ga0207667_10339658 3300025949 Bacteria 1533
69 Ga0207658_10029079 3300025986 Bacteria 3898
70 Ga0207677_10209376 3300026023 Bacteria 1556
71 Ga0207703_10000141 3300026035 Bacteria 86068
72 Ga0207639_10005098 3300026041 Bacteria 8855
73 Ga0207639_10022965 3300026041 Bacteria 4499
74 Ga0207702_10034095 3300026078 Bacteria 4254
75 Ga0207702_10106435 3300026078 Bacteria 2485
76 Ga0207641_10028355 3300026088 Bacteria 4626
77 Ga0207674_10015557 3300026116 Bacteria 8355
78 Ga0207674_10426479 3300026116 Bacteria 1281
79 Ga0207698_10002260 3300026142 Bacteria 11394
80 Ga0207698_10014974 3300026142 Bacteria 5176
81 Ga0307405_10289612 3300031731 Bacteria 1237
82 Ga0307410_10205372 3300031852 Bacteria 1507
83 Ga0307406_10028175 3300031901 Bacteria 3392
84 Ga0451793_0123529 3300041452 Bacteria 1648
85 Ga0451806_062005 3300041462 Bacteria 2910
86 Ga0439462_0020196 3300042015 Bacteria 1736
87 Ga0450918_033826 3300042531 Bacteria 907
88 Ga0466965_0000009 3300044683 Bacteria 122488
89 Ga0466968_0009883 3300044735 Bacteria 3683
90 Ga0495650_0001402 3300046471 Bacteria 23574
91 Ga0495686_0140942 3300047472 Bacteria 1423
92 Ga0496104_0315819 3300048907 Bacteria 1475
93 Ga0496105_0182221 3300048908 Bacteria 1719
94 Ga0496105_0287301 3300048908 Bacteria 1325
95 Ga0496110_0039259 3300048913 Bacteria 4122
96 Ga0496110_0127251 3300048913 Bacteria 2299
97 Ga0496111_0563752 3300048914 Bacteria 835
98 Ga0496113_0244825 3300048916 Bacteria 1431
99 Ga0496114_0019580 3300048917 Bacteria 5484
100 Ga0496115_0154898 3300048918 Bacteria 1893
101 Ga0496117_0000028 3300048920 Bacteria 407392
102 Ga0496119_0001517 3300048922 Bacteria 27747
103 Ga0496119_0001615 3300048922 Bacteria 26709
104 Ga0496120_0000426 3300048923 Bacteria 66901
105 Ga0496120_0001547 3300048923 Bacteria 26928
106 Ga0496121_0000891 3300048924 Bacteria 53863
107 Ga0496122_0093312 3300048925 Bacteria 2042
108 Ga0496124_0006853 3300048927 Bacteria 12269
109 Ga0496125_0008113 3300048928 Bacteria 11060
110 Ga0496126_0012176 3300048929 Bacteria 8828
111 Ga0501031_0359137 3300049568 Bacteria 943
112 Ga0501032_0015771 3300049569 Bacteria 5328
113 Ga0501033_0014847 3300049570 Bacteria 5913
114 Ga0501034_0038353 3300049571 Bacteria 4851
115 Ga0501034_0288376 3300049571 Bacteria 1580
116 Ga0501036_0347288 3300049572 Bacteria 1239
117 Ga0501037_0009764 3300049573 Bacteria 7047
118 Ga0501038_0038599 3300049574 Bacteria 4181
119 Ga0501039_0083947 3300049575 Bacteria 2481
120 Ga0501043_0052146 3300049579 Bacteria 3214
121 Ga0501043_0179290 3300049579 Bacteria 1651
122 Ga0501047_0007683 3300049581 Bacteria 10157
123 Ga0501047_0088461 3300049581 Bacteria 2974
124 Ga0501070_0036429 3300049586 Bacteria 4108
125 Ga0501073_0017075 3300049589 Bacteria 5257
126 Ga0501035_0004104 3300049822 Bacteria 13845
127 Ga0501035_0290099 3300049822 Bacteria 1381
128 Ga0501044_0001106 3300049823 Bacteria 32051
129 Ga0501044_0015621 3300049823 Bacteria 8178
130 Ga0501044_0250404 3300049823 Bacteria 1713
131 nmdc:mga03n38_14767_c1 3300050490 Bacteria 3002
132 nmdc:mga00v17_76584_c1 3300050491 Bacteria 2081
133 nmdc:mga0yw44_66232_c1 3300050492 Bacteria 2229
134 nmdc:mga06z11_5323_c1 3300050494 Bacteria 5156
135 nmdc:mga0sz30_56241_c1 3300050516 Bacteria 1675
136 Ga0500635_0060241 3300053080 Bacteria 1323
137 Ga0500651_0000368 3300053093 Bacteria 24842
138 Ga0500568_0000304 3300053139 Bacteria 39367
139 Ga0500588_0001965 3300053146 Bacteria 4062
140 Ga0500620_000032 3300053155 Bacteria 27722

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048925 Ga0496122_0093312 Ga0496122_0093312_1323_2009 222
2 3300048914 Ga0496111_0563752 Ga0496111_0563752_115_798 223
3 3300025928 Ga0207700_10018485 Ga0207700_100184853 230
4 3300048922 Ga0496119_0001517 Ga0496119_0001517_10086_10919 230
5 3300049571 Ga0501034_0288376 Ga0501034_0288376_415_1257 234
6 3300049572 Ga0501036_0347288 Ga0501036_0347288_230_1072 234
7 3300049573 Ga0501037_0009764 Ga0501037_0009764_2112_2954 234
8 3300049581 Ga0501047_0007683 Ga0501047_0007683_2184_3026 234
9 3300049822 Ga0501035_0004104 Ga0501035_0004104_12651_13493 234
10 3300049823 Ga0501044_0001106 Ga0501044_0001106_2400_3242 234
11 3300049822 Ga0501035_0290099 Ga0501035_0290099_216_1052 243
12 3300048924 Ga0496121_0000891 Ga0496121_0000891_27468_28319 245
13 3300049571 Ga0501034_0038353 Ga0501034_0038353_3622_4458 245
14 3300048908 Ga0496105_0287301 Ga0496105_0287301_240_1127 246
15 3300049568 Ga0501031_0359137 Ga0501031_0359137_92_925 246
16 3300049575 Ga0501039_0083947 Ga0501039_0083947_711_1529 247
17 3300049579 Ga0501043_0179290 Ga0501043_0179290_712_1530 247
18 3300049581 Ga0501047_0088461 Ga0501047_0088461_1316_2152 248
19 3300044683 Ga0466965_0000009 Ga0466965_0000009_89867_90685 249
20 3300053146 Ga0500588_0001965 Ga0500588_0001965_993_1817 249
21 3300005335 Ga0070666_10105077 Ga0070666_101050773 250
22 3300005841 Ga0068863_100057657 Ga0068863_1000576573 250
23 3300009177 Ga0105248_10000681 Ga0105248_100006816 250
24 3300025941 Ga0207711_10007361 Ga0207711_100073618 250
25 3300026088 Ga0207641_10028355 Ga0207641_100283554 250
26 3300005435 Ga0070714_100217931 Ga0070714_1002179312 251
27 3300049570 Ga0501033_0014847 Ga0501033_0014847_3317_4153 254
28 3300049579 Ga0501043_0052146 Ga0501043_0052146_1546_2382 254
29 3300049586 Ga0501070_0036429 Ga0501070_0036429_1522_2358 254
30 3300049589 Ga0501073_0017075 Ga0501073_0017075_2845_3657 254
31 3300049823 Ga0501044_0250404 Ga0501044_0250404_749_1585 254
32 3300005327 Ga0070658_10173222 Ga0070658_101732223 255
33 3300005563 Ga0068855_100027328 Ga0068855_1000273286 255
34 3300025909 Ga0207705_10180493 Ga0207705_101804932 255
35 3300049569 Ga0501032_0015771 Ga0501032_0015771_4057_4896 257
36 3300049574 Ga0501038_0038599 Ga0501038_0038599_2939_3778 257
37 3300048920 Ga0496117_0000028 Ga0496117_0000028_225461_226294 258
38 3300048928 Ga0496125_0008113 Ga0496125_0008113_4925_5758 258
39 3300048916 Ga0496113_0244825 Ga0496113_0244825_36_869 259
40 3300048923 Ga0496120_0001547 Ga0496120_0001547_21925_22758 260
41 3300048927 Ga0496124_0006853 Ga0496124_0006853_11391_12224 260
42 3300048929 Ga0496126_0012176 Ga0496126_0012176_1896_2729 260
43 iso_pu_bacteria 2585428157 2588106700 261
44 3300048918 Ga0496115_0154898 Ga0496115_0154898_834_1667 262
45 3300047472 Ga0495686_0140942 Ga0495686_0140942_315_1133 263
46 3300009148 Ga0105243_10042762 Ga0105243_100427622 267
47 3300025935 Ga0207709_10023134 Ga0207709_100231342 267
48 iso_pu_bacteria 2821268502 2821269408 268
49 iso_pu_bacteria 2852643534 2852645863 268
50 iso_pu_bacteria 2643221597 2643996400 269
51 iso_pu_bacteria 2808606306 2808631700 269
52 iso_pu_bacteria 2808606368 2808885087 269
53 iso_pu_bacteria 2852632344 2852633091 269
54 3300048913 Ga0496110_0127251 Ga0496110_0127251_207_1046 270
55 iso_pu_bacteria 2643221566 2643849420 270
56 iso_pu_bacteria 2773857763 2774400204 270
57 iso_pu_bacteria 2857737099 2857738733 270
58 iso_pu_bacteria 2870628048 2870629773 270
59 iso_pu_bacteria 8045830549 8045832676 270
60 3300042015 Ga0439462_0020196 Ga0439462_0020196_233_1057 271
61 3300053139 Ga0500568_0000304 Ga0500568_0000304_27093_27923 271
62 3300006038 Ga0075365_10088910 Ga0075365_100889102 272
63 3300042531 Ga0450918_033826 Ga0450918_033826_43_876 272
64 3300048907 Ga0496104_0315819 Ga0496104_0315819_632_1465 272
65 3300048908 Ga0496105_0182221 Ga0496105_0182221_552_1385 272
66 3300048913 Ga0496110_0039259 Ga0496110_0039259_2681_3514 272
67 3300048917 Ga0496114_0019580 Ga0496114_0019580_4577_5410 272
68 3300049823 Ga0501044_0015621 Ga0501044_0015621_3645_4481 272
69 3300050490 nmdc:mga03n38_14767_c1 nmdc:mga03n38_14767_c1_1955_2788 272
70 3300050491 nmdc:mga00v17_76584_c1 nmdc:mga00v17_76584_c1_735_1568 272
71 3300050492 nmdc:mga0yw44_66232_c1 nmdc:mga0yw44_66232_c1_887_1720 272
72 3300050494 nmdc:mga06z11_5323_c1 nmdc:mga06z11_5323_c1_2462_3295 272
73 3300050516 nmdc:mga0sz30_56241_c1 nmdc:mga0sz30_56241_c1_634_1467 272
74 3300005548 Ga0070665_100078265 Ga0070665_1000782652 273
75 3300025728 Ga0207655_1009321 Ga0207655_10093212 273
76 3300005618 Ga0068864_100033064 Ga0068864_1000330643 274
77 3300005842 Ga0068858_100000276 Ga0068858_10000027650 274
78 3300013250 Ga0171462_1001 Ga0171462_1001218 274
79 3300014325 Ga0163163_10227033 Ga0163163_102270333 274
80 3300026035 Ga0207703_10000141 Ga0207703_1000014149 274
81 3300031731 Ga0307405_10289612 Ga0307405_102896122 274
82 3300031852 Ga0307410_10205372 Ga0307410_102053722 274
83 3300031901 Ga0307406_10028175 Ga0307406_100281753 274
84 3300041452 Ga0451793_0123529 Ga0451793_0123529_245_1084 274
85 3300041462 Ga0451806_062005 Ga0451806_062005_1879_2724 274
86 3300044735 Ga0466968_0009883 Ga0466968_0009883_2779_3621 274
87 3300006038 Ga0075365_10008356 Ga0075365_100083562 275
88 3300046471 Ga0495650_0001402 Ga0495650_0001402_19331_20182 276
89 3300005543 Ga0070672_100030545 Ga0070672_1000305453 277
90 3300005563 Ga0068855_100005174 Ga0068855_10000517414 277
91 3300005563 Ga0068855_100382244 Ga0068855_1003822442 277
92 3300005614 Ga0068856_100142248 Ga0068856_1001422483 277
93 3300005616 Ga0068852_100007241 Ga0068852_1000072419 277
94 3300005616 Ga0068852_100045478 Ga0068852_1000454785 277
95 3300005834 Ga0068851_10000014 Ga0068851_10000014173 277
96 3300009093 Ga0105240_10002898 Ga0105240_100028988 277
97 3300009101 Ga0105247_10009201 Ga0105247_100092015 277
98 3300009174 Ga0105241_10003266 Ga0105241_100032668 277
99 3300009177 Ga0105248_10193754 Ga0105248_101937543 277
100 3300009545 Ga0105237_10016997 Ga0105237_100169976 277
101 3300009551 Ga0105238_10032429 Ga0105238_100324292 277
102 3300010375 Ga0105239_10062592 Ga0105239_100625923 277
103 3300025321 Ga0207656_10000002 Ga0207656_10000002438 277
104 3300025911 Ga0207654_10000001 Ga0207654_100000011430 277
105 3300025913 Ga0207695_10009994 Ga0207695_100099948 277
106 3300025914 Ga0207671_10000002 Ga0207671_10000002732 277
107 3300025924 Ga0207694_10000274 Ga0207694_1000027415 277
108 3300025927 Ga0207687_10073997 Ga0207687_100739973 277
109 3300025940 Ga0207691_10045133 Ga0207691_100451333 277
110 3300025941 Ga0207711_10111125 Ga0207711_101111252 277
111 3300025949 Ga0207667_10001177 Ga0207667_100011777 277
112 3300025949 Ga0207667_10208414 Ga0207667_102084142 277
113 3300026023 Ga0207677_10209376 Ga0207677_102093762 277
114 3300026078 Ga0207702_10106435 Ga0207702_101064353 277
115 3300026116 Ga0207674_10015557 Ga0207674_100155577 277
116 3300026142 Ga0207698_10002260 Ga0207698_1000226011 277
117 3300026142 Ga0207698_10014974 Ga0207698_100149743 277
118 3300048922 Ga0496119_0001615 Ga0496119_0001615_13543_14400 277
119 3300048923 Ga0496120_0000426 Ga0496120_0000426_40530_41387 277
120 3300053080 Ga0500635_0060241 Ga0500635_0060241_151_999 277
121 3300053093 Ga0500651_0000368 Ga0500651_0000368_14158_14991 277
122 3300053155 Ga0500620_000032 Ga0500620_000032_23762_24595 277
123 3300005327 Ga0070658_10007925 Ga0070658_100079259 282
124 3300005338 Ga0068868_100201318 Ga0068868_1002013182 282
125 3300005339 Ga0070660_100014578 Ga0070660_1000145784 282
126 3300005366 Ga0070659_100000149 Ga0070659_10000014952 282
127 3300005367 Ga0070667_100015030 Ga0070667_1000150308 282
128 3300005539 Ga0068853_100034953 Ga0068853_1000349535 282
129 3300005539 Ga0068853_100083148 Ga0068853_1000831483 282
130 3300005563 Ga0068855_100261765 Ga0068855_1002617651 282
131 3300005563 Ga0068855_100261766 Ga0068855_1002617661 282
132 3300005577 Ga0068857_100160525 Ga0068857_1001605252 282
133 3300005614 Ga0068856_100015493 Ga0068856_1000154936 282
134 3300009093 Ga0105240_10823419 Ga0105240_108234192 282
135 3300009098 Ga0105245_10023393 Ga0105245_100233934 282
136 3300009545 Ga0105237_10336753 Ga0105237_103367532 282
137 3300009551 Ga0105238_10075761 Ga0105238_100757612 282
138 3300010375 Ga0105239_10437305 Ga0105239_104373052 282
139 3300010375 Ga0105239_10893789 Ga0105239_108937892 282
140 3300014968 Ga0157379_10008422 Ga0157379_100084227 282
141 3300025913 Ga0207695_10002117 Ga0207695_1000211726 282
142 3300025919 Ga0207657_10004316 Ga0207657_1000431611 282
143 3300025924 Ga0207694_10046649 Ga0207694_100466494 282
144 3300025927 Ga0207687_10107625 Ga0207687_101076252 282
145 3300025932 Ga0207690_10001692 Ga0207690_1000169213 282
146 3300025949 Ga0207667_10000272 Ga0207667_1000027256 282
147 3300025949 Ga0207667_10339658 Ga0207667_103396581 282
148 3300025986 Ga0207658_10029079 Ga0207658_100290795 282
149 3300026041 Ga0207639_10005098 Ga0207639_100050986 282
150 3300026041 Ga0207639_10022965 Ga0207639_100229652 282
151 3300026078 Ga0207702_10034095 Ga0207702_100340953 282
152 3300026116 Ga0207674_10426479 Ga0207674_104264792 282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11296

DUF3097_C

DUF3097, C-terminal domain

127

289

0.98

PF22845

DUF3097_N

DUF3097, N-terminal domain

36

93

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hw9-assembly1.cif.gz_E crystal structure of helicobacter pylori mscs (closed state) 0.8098 31 67
8tdm-assembly1.cif.gz_A cryo-em structure of atmsl10-k539e 0.8071 32 67
8tdj-assembly1.cif.gz_B cryo-em structure of the wild-type atmsl10 in gdn 0.803 32 67
7egt-assembly2.cif.gz_B the crystal structure of the c-terminal domain of t. thermophilus uvrd complexed with the n-terminal domain of uvrb 0.7941 31 67
7dhw-assembly1.cif.gz_A crystal structure of myosin-xi motor domain in complex with adp-alf4 0.7928 33 67
ID Description Score Start End Superfamily
af_Q54V25_1_59_3.30.920.30 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8811 44 67 3.30.920.30
af_P75783_574_621_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.8699 31 67 2.30.30.60
af_P77338_945_994_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.859 31 67 2.30.30.60
af_A0A0R0ELK1_770_819_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.8473 31 67 2.30.30.60
af_O13936_472_519_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8422 31 67 2.30.30.30
ID Description Score Start End GO Terms
AF-E7NC91-F1-model_v4 DUF3097 domain-containing protein 0.9582 114 282
AF-A0A4Q3IQT2-F1-model_v4 deleted 0.9463 127 281
AF-A0A6J6IBJ3-F1-model_v4 Unannotated protein 0.9456 110 282
AF-A0A4Q3IQT2-F1-model_v4 deleted 0.9403 127 281
AF-A0A652K0G9-F1-model_v4 DUF3097 family protein 0.937 99 282

Feature Viewer

pLDDT pTM Quality
83.13 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map