F213637

General Info

Members Datasets Scaffolds Average Seq Length
152 121 304 150

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_101451348|Ga0070711_1014513481
Length 172
Sequence VLGRYWLDEDAMRLVIQRVTRAAVRVGDETVGEIGEGLLVLVGVREGDTELEAQRLAVKTAELRIFRDDEGRFNRSLLEVGPGTTSGRAEALVVSQFTLYGDVRRGRRPSFNEAARPELAEPIVEAYTVALEAEGLRVARGRFGAMMQVESVNDGPVTIIVDSADFEKRRTG

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
56 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
57 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
60 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
61 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
62 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
63 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
64 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
68 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
69 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
70 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
77 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
78 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
79 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
80 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
81 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
82 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
83 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
84 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
85 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
86 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
97 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
98 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
99 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
100 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
101 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
102 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
104 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
105 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
106 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
107 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
108 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
109 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
110 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
111 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
112 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
113 2860837431 Bacillus sp. WR11 Isolate Unclassified
114 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
115 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
116 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
117 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
118 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
119 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
120 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
121 8022653035 Bacillus sp. Rc4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.76
Metatranscriptomes 0
Isolates 7.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.84
Nodule 0
Rhizoplane 5.26
Rhizosphere 78.95
Stem 0
Stem Tuber 0
Unclassified 8.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_101451348 3300005439 Bacteria 598
2 rootL2_10000104 3300003322 Bacteria 2934
3 Ga0055532_1025117 3300003758 Bacteria 589
4 Ga0070670_100576893 3300005331 Bacteria 1005
5 Ga0070680_100201408 3300005336 Bacteria 1679
6 Ga0070682_100015024 3300005337 Bacteria 4482
7 Ga0070674_100374715 3300005356 Bacteria 1156
8 Ga0070709_10003184 3300005434 Bacteria 8803
9 Ga0070713_100241344 3300005436 Bacteria 1645
10 Ga0070710_10254845 3300005437 Bacteria 1129
11 Ga0070663_100018230 3300005455 Bacteria 4597
12 Ga0070678_100052207 3300005456 Bacteria 2967
13 Ga0070681_10112526 3300005458 Bacteria 2662
14 Ga0070685_10261968 3300005466 Bacteria 1150
15 Ga0070679_100149392 3300005530 Bacteria 2314
16 Ga0068853_100144485 3300005539 Unclassified 2137
17 Ga0070696_100153073 3300005546 Bacteria 1694
18 Ga0070664_100933392 3300005564 Unclassified 814
19 Ga0068856_100275281 3300005614 Bacteria 1700
20 Ga0070702_100339356 3300005615 Bacteria 1054
21 Ga0068859_100738512 3300005617 Bacteria 1074
22 Ga0068870_10077476 3300005840 Bacteria 1829
23 Ga0068863_100084256 3300005841 Unclassified 3013
24 Ga0070717_10009925 3300006028 Bacteria 7165
25 Ga0075365_10016322 3300006038 Bacteria 4515
26 Ga0075365_10061056 3300006038 Bacteria 2516
27 Ga0075365_10235681 3300006038 Bacteria 1285
28 Ga0075365_10466957 3300006038 Bacteria 891
29 Ga0075363_100285631 3300006048 Bacteria 955
30 Ga0075363_100368623 3300006048 Bacteria 841
31 Ga0075364_10230852 3300006051 Bacteria 1256
32 Ga0070715_10005199 3300006163 Bacteria 4325
33 Ga0070716_100157617 3300006173 Bacteria 1467
34 Ga0097621_101997505 3300006237 Unclassified 554
35 Ga0075370_10391335 3300006353 Unclassified 833
36 Ga0075435_100108094 3300007076 Bacteria 2311
37 Ga0114129_12237907 3300009147 Bacteria 657
38 Ga0105241_10057309 3300009174 Bacteria 2988
39 Ga0157370_10857361 3300013104 Bacteria 825
40 Ga0157378_12441033 3300013297 Bacteria 575
41 Ga0157372_10441204 3300013307 Bacteria 1517
42 Ga0157376_10004722 3300014969 Bacteria 9493
43 Ga0163161_10111721 3300017792 Bacteria 2044
44 Ga0207692_10362254 3300025898 Bacteria 896
45 Ga0207643_10164092 3300025908 Bacteria 1338
46 Ga0207643_10206319 3300025908 Bacteria 1198
47 Ga0207654_10775204 3300025911 Bacteria 692
48 Ga0207663_10014333 3300025916 Bacteria 4335
49 Ga0207652_10347565 3300025921 Bacteria 1339
50 Ga0207652_11021063 3300025921 Bacteria 726
51 Ga0207664_10033907 3300025929 Bacteria 3928
52 Ga0207690_10824038 3300025932 Bacteria 767
53 Ga0207665_10001319 3300025939 Bacteria 16733
54 Ga0207691_10402628 3300025940 Bacteria 1167
55 Ga0207679_10946267 3300025945 Unclassified 789
56 Ga0207639_10290702 3300026041 Unclassified 1441
57 Ga0207678_10010343 3300026067 Bacteria 8189
58 Ga0207708_10450473 3300026075 Bacteria 1072
59 Ga0207702_10937834 3300026078 Bacteria 858
60 Ga0207683_10023388 3300026121 Bacteria 5315
61 Ga0209968_1001748 3300027526 Bacteria 3290
62 Ga0265331_10017486 3300031250 Unclassified 3737
63 Ga0265327_10000726 3300031251 Bacteria 51653
64 Ga0307416_101855136 3300032002 Bacteria 706
65 Ga0307415_100046107 3300032126 Bacteria 2927
66 Ga0373930_0076687 3300034816 Bacteria 767
67 Ga0373929_0222156 3300035085 Bacteria 538
68 Ga0373931_0053852 3300035691 Bacteria 2148
69 Ga0373931_0107994 3300035691 Bacteria 1574
70 Ga0373935_1281110 3300035692 Bacteria 547
71 Ga0373937_0727100 3300036401 Unclassified 940
72 Ga0395900_0636416 3300037418 Bacteria 1004
73 Ga0395905_0014670 3300037471 Bacteria 7475
74 Ga0451837_1214336 3300041494 Bacteria 1681
75 Ga0451855_0864791 3300041511 Bacteria 2447
76 Ga0451855_1865371 3300041511 Bacteria 3488
77 Ga0451577_0000249 3300042876 Bacteria 106109
78 Ga0451577_0017311 3300042876 Bacteria 6661
79 Ga0451577_0063385 3300042876 Bacteria 3297
80 Ga0451577_0076184 3300042876 Unclassified 2991
81 Ga0451577_0554843 3300042876 Bacteria 1043
82 Ga0453683_0008430 3300044673 Bacteria 6912
83 Ga0453683_0030131 3300044673 Bacteria 3431
84 Ga0466963_0265357 3300044694 Bacteria 1206
85 Ga0466964_0043067 3300044706 Bacteria 1830
86 Ga0453684_0022708 3300044712 Bacteria 9295
87 Ga0453684_0053433 3300044712 Bacteria 5273
88 Ga0453684_0109452 3300044712 Bacteria 3361
89 Ga0453684_0126318 3300044712 Bacteria 3077
90 Ga0453684_0201083 3300044712 Bacteria 2322
91 Ga0453684_0543430 3300044712 Unclassified 1281
92 Ga0451576_0000644 3300045051 Bacteria 72113
93 Ga0451576_0001015 3300045051 Bacteria 51898
94 Ga0451576_0014403 3300045051 Bacteria 8804
95 Ga0451576_0017127 3300045051 Bacteria 7971
96 Ga0466967_0162911 3300045976 Bacteria 2094
97 Ga0495607_0105883 3300046501 Bacteria 1498
98 Ga0495607_0316762 3300046501 Unclassified 729
99 Ga0495645_0026201 3300046543 Bacteria 4231
100 Ga0496100_0035238 3300048903 Bacteria 3146
101 Ga0496101_0123387 3300048904 Bacteria 1960
102 Ga0496105_0099668 3300048908 Bacteria 2399
103 Ga0496106_0068221 3300048909 Bacteria 2712
104 Ga0496107_0089745 3300048910 Bacteria 2244
105 Ga0496110_0949911 3300048913 Bacteria 766
106 Ga0496111_0029326 3300048914 Bacteria 3907
107 Ga0496112_0095797 3300048915 Bacteria 2938
108 Ga0501031_0027114 3300049568 Bacteria 3734
109 Ga0501032_0051961 3300049569 Bacteria 2762
110 Ga0501034_0239632 3300049571 Bacteria 1760
111 Ga0501034_0276345 3300049571 Bacteria 1619
112 Ga0501036_0032416 3300049572 Bacteria 4414
113 Ga0501036_0180189 3300049572 Bacteria 1779
114 Ga0501036_0921266 3300049572 Bacteria 717
115 Ga0501038_0036670 3300049574 Bacteria 4302
116 Ga0501041_0182721 3300049577 Bacteria 1313
117 Ga0501042_0146283 3300049578 Bacteria 1704
118 Ga0501043_0241531 3300049579 Bacteria 1393
119 Ga0501046_0474370 3300049580 Bacteria 898
120 Ga0501047_0309911 3300049581 Bacteria 1419
121 Ga0501068_0183293 3300049584 Bacteria 1324
122 Ga0501072_0138082 3300049588 Bacteria 1944
123 Ga0501077_0111691 3300049593 Bacteria 1732
124 Ga0501079_0386859 3300049741 Bacteria 1097
125 Ga0501080_0191383 3300049742 Bacteria 1880
126 Ga0501083_0682399 3300049744 Bacteria 668
127 Ga0501035_0338555 3300049822 Bacteria 1261
128 Ga0501035_0350516 3300049822 Bacteria 1235
129 Ga0501044_0004089 3300049823 Bacteria 16365
130 Ga0501044_0080440 3300049823 Bacteria 3301
131 nmdc:mga03n38_683029_c1 3300050490 Bacteria 591
132 nmdc:mga00v17_300292_c1 3300050491 Bacteria 1043
133 nmdc:mga00v17_50203_c1 3300050491 Bacteria 2533
134 nmdc:mga0yw44_118851_c1 3300050492 Bacteria 1701
135 nmdc:mga0yw44_261754_c1 3300050492 Bacteria 1153
136 nmdc:mga0yw44_413199_c1 3300050492 Bacteria 913
137 nmdc:mga07m45_487462_c1 3300050496 Unclassified 714
138 nmdc:mga07m45_81458_c1 3300050496 Bacteria 1003
139 nmdc:mga05p37_1197492_c1 3300050507 Bacteria 785
140 Ga0500554_017506 3300053102 Bacteria 1916
141 Ga0501082_0108666 3300060353 Bacteria 2400
142 2540607641 2540341094 Bacteria 4061186
143 2809055596 2808606399 Bacteria 4021018
144 2860840410 2860837431 Bacteria 4202080
145 2958513908 2958512119 Bacteria 4528530
146 2962293612 2962290636 Bacteria 4072939
147 2965323776 2965320100 Bacteria 3975600
148 2969139617 2969136845 Bacteria 3923176
149 2969767659 2969765954 Bacteria 4216713
150 2969773031 2969770375 Bacteria 4271280
151 2980495403 2980492589 Bacteria 4072961
152 8022654579 8022653035 Bacteria 4035078
153 Ga0070711_101451348
154 rootL2_10000104
155 Ga0055532_1025117
156 Ga0070670_100576893
157 Ga0070680_100201408
158 Ga0070682_100015024
159 Ga0070674_100374715
160 Ga0070709_10003184
161 Ga0070713_100241344
162 Ga0070710_10254845
163 Ga0070663_100018230
164 Ga0070678_100052207
165 Ga0070681_10112526
166 Ga0070685_10261968
167 Ga0070679_100149392
168 Ga0068853_100144485
169 Ga0070696_100153073
170 Ga0070664_100933392
171 Ga0068856_100275281
172 Ga0070702_100339356
173 Ga0068859_100738512
174 Ga0068870_10077476
175 Ga0068863_100084256
176 Ga0070717_10009925
177 Ga0075365_10016322
178 Ga0075365_10061056
179 Ga0075365_10235681
180 Ga0075365_10466957
181 Ga0075363_100285631
182 Ga0075363_100368623
183 Ga0075364_10230852
184 Ga0070715_10005199
185 Ga0070716_100157617
186 Ga0097621_101997505
187 Ga0075370_10391335
188 Ga0075435_100108094
189 Ga0114129_12237907
190 Ga0105241_10057309
191 Ga0157370_10857361
192 Ga0157378_12441033
193 Ga0157372_10441204
194 Ga0157376_10004722
195 Ga0163161_10111721
196 Ga0207692_10362254
197 Ga0207643_10164092
198 Ga0207643_10206319
199 Ga0207654_10775204
200 Ga0207663_10014333
201 Ga0207652_10347565
202 Ga0207652_11021063
203 Ga0207664_10033907
204 Ga0207690_10824038
205 Ga0207665_10001319
206 Ga0207691_10402628
207 Ga0207679_10946267
208 Ga0207639_10290702
209 Ga0207678_10010343
210 Ga0207708_10450473
211 Ga0207702_10937834
212 Ga0207683_10023388
213 Ga0209968_1001748
214 Ga0265331_10017486
215 Ga0265327_10000726
216 Ga0307416_101855136
217 Ga0307415_100046107
218 Ga0373930_0076687
219 Ga0373929_0222156
220 Ga0373931_0053852
221 Ga0373931_0107994
222 Ga0373935_1281110
223 Ga0373937_0727100
224 Ga0395900_0636416
225 Ga0395905_0014670
226 Ga0451837_1214336
227 Ga0451855_0864791
228 Ga0451855_1865371
229 Ga0451577_0000249
230 Ga0451577_0017311
231 Ga0451577_0063385
232 Ga0451577_0076184
233 Ga0451577_0554843
234 Ga0453683_0008430
235 Ga0453683_0030131
236 Ga0466963_0265357
237 Ga0466964_0043067
238 Ga0453684_0022708
239 Ga0453684_0053433
240 Ga0453684_0109452
241 Ga0453684_0126318
242 Ga0453684_0201083
243 Ga0453684_0543430
244 Ga0451576_0000644
245 Ga0451576_0001015
246 Ga0451576_0014403
247 Ga0451576_0017127
248 Ga0466967_0162911
249 Ga0495607_0105883
250 Ga0495607_0316762
251 Ga0495645_0026201
252 Ga0496100_0035238
253 Ga0496101_0123387
254 Ga0496105_0099668
255 Ga0496106_0068221
256 Ga0496107_0089745
257 Ga0496110_0949911
258 Ga0496111_0029326
259 Ga0496112_0095797
260 Ga0501031_0027114
261 Ga0501032_0051961
262 Ga0501034_0239632
263 Ga0501034_0276345
264 Ga0501036_0032416
265 Ga0501036_0180189
266 Ga0501036_0921266
267 Ga0501038_0036670
268 Ga0501041_0182721
269 Ga0501042_0146283
270 Ga0501043_0241531
271 Ga0501046_0474370
272 Ga0501047_0309911
273 Ga0501068_0183293
274 Ga0501072_0138082
275 Ga0501077_0111691
276 Ga0501079_0386859
277 Ga0501080_0191383
278 Ga0501083_0682399
279 Ga0501035_0338555
280 Ga0501035_0350516
281 Ga0501044_0004089
282 Ga0501044_0080440
283 nmdc:mga03n38_683029_c1
284 nmdc:mga00v17_300292_c1
285 nmdc:mga00v17_50203_c1
286 nmdc:mga0yw44_118851_c1
287 nmdc:mga0yw44_261754_c1
288 nmdc:mga0yw44_413199_c1
289 nmdc:mga07m45_487462_c1
290 nmdc:mga07m45_81458_c1
291 nmdc:mga05p37_1197492_c1
292 Ga0500554_017506
293 Ga0501082_0108666
294 2540607641
295 2809055596
296 2860840410
297 2958513908
298 2962293612
299 2965323776
300 2969139617
301 2969767659
302 2969773031
303 2980495403
304 8022654579

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02580

Tyr_Deacylase

D-Tyr-tRNA(Tyr) deacylase

13

162

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.9614 1 160
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.9562 1 159
2dbo-assembly1.cif.gz_A-2 crystal structure of d-tyr-trna(tyr) deacylase from aquifex aeolicus 0.9557 1 162
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.9485 1 160
3lmv-assembly3.cif.gz_F d-tyr-trna(tyr) deacylase from plasmodium falciparum in complex with hepes 0.9431 1 162
ID Description Score Start End Superfamily
af_Q2FXU2_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9649 1 160 3.50.80.10
1j7gA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9614 1 160 3.50.80.10
2dboA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9557 1 162 3.50.80.10
1j7gA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9485 1 160 3.50.80.10
af_Q07648_1_150_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9451 1 162 3.50.80.10
ID Description Score Start End GO Terms
AF-Q1ATQ8-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) 0.9888 1 160 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A132P4S2-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9879 1 162 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A1V5TTS5-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9868 1 164 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A651G0J7-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9852 1 165 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-R6WJP5-F1-model_v4 D-tyrosyl-tRNA(Tyr) deacylase 0.985 1 163 GO:0000049
GO:0005737
GO:0051500

Map