F213637
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 152 | 121 | 304 | 150 |
Family's Representative Sequence
| Representative Sequence | 3300005439|Ga0070711_101451348|Ga0070711_1014513481 |
| Length | 172 |
| Sequence | VLGRYWLDEDAMRLVIQRVTRAAVRVGDETVGEIGEGLLVLVGVREGDTELEAQRLAVKTAELRIFRDDEGRFNRSLLEVGPGTTSGRAEALVVSQFTLYGDVRRGRRPSFNEAARPELAEPIVEAYTVALEAEGLRVARGRFGAMMQVESVNDGPVTIIVDSADFEKRRTG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 17 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 20 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 22 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 23 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 24 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 26 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 27 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 28 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 32 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 33 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 57 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 58 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 59 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 60 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 61 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 62 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 63 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 64 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 65 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 66 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 67 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 68 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 69 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 70 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 71 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 72 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 73 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 74 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 75 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 76 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 79 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 80 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 81 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 82 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 83 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 84 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 85 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 86 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 87 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 88 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 89 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 90 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 91 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 92 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 93 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 94 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 95 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 96 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 97 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 98 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 99 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 100 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 101 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 102 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 103 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 104 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 105 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 106 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 107 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 108 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 109 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 110 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 111 | 2540341094 | Bacillus subtilis XF-1 | Isolate | Rhizosphere |
| 112 | 2808606399 | Bacillus sp. SJZ110 | Isolate | Rhizosphere |
| 113 | 2860837431 | Bacillus sp. WR11 | Isolate | Unclassified |
| 114 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 115 | 2962290636 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 116 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
| 117 | 2969136845 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 118 | 2969765954 | Bacillus intestinalis GM2 | Isolate | Rhizosphere |
| 119 | 2969770375 | Bacillus subtilis GM5 | Isolate | Rhizosphere |
| 120 | 2980492589 | Bacillus subtilis GQJK2 | Isolate | Rhizosphere |
| 121 | 8022653035 | Bacillus sp. Rc4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.76 |
| Metatranscriptomes | 0 |
| Isolates | 7.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.84 |
| Nodule | 0 |
| Rhizoplane | 5.26 |
| Rhizosphere | 78.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070711_101451348 | 3300005439 | Bacteria | 598 |
| 2 | rootL2_10000104 | 3300003322 | Bacteria | 2934 |
| 3 | Ga0055532_1025117 | 3300003758 | Bacteria | 589 |
| 4 | Ga0070670_100576893 | 3300005331 | Bacteria | 1005 |
| 5 | Ga0070680_100201408 | 3300005336 | Bacteria | 1679 |
| 6 | Ga0070682_100015024 | 3300005337 | Bacteria | 4482 |
| 7 | Ga0070674_100374715 | 3300005356 | Bacteria | 1156 |
| 8 | Ga0070709_10003184 | 3300005434 | Bacteria | 8803 |
| 9 | Ga0070713_100241344 | 3300005436 | Bacteria | 1645 |
| 10 | Ga0070710_10254845 | 3300005437 | Bacteria | 1129 |
| 11 | Ga0070663_100018230 | 3300005455 | Bacteria | 4597 |
| 12 | Ga0070678_100052207 | 3300005456 | Bacteria | 2967 |
| 13 | Ga0070681_10112526 | 3300005458 | Bacteria | 2662 |
| 14 | Ga0070685_10261968 | 3300005466 | Bacteria | 1150 |
| 15 | Ga0070679_100149392 | 3300005530 | Bacteria | 2314 |
| 16 | Ga0068853_100144485 | 3300005539 | Unclassified | 2137 |
| 17 | Ga0070696_100153073 | 3300005546 | Bacteria | 1694 |
| 18 | Ga0070664_100933392 | 3300005564 | Unclassified | 814 |
| 19 | Ga0068856_100275281 | 3300005614 | Bacteria | 1700 |
| 20 | Ga0070702_100339356 | 3300005615 | Bacteria | 1054 |
| 21 | Ga0068859_100738512 | 3300005617 | Bacteria | 1074 |
| 22 | Ga0068870_10077476 | 3300005840 | Bacteria | 1829 |
| 23 | Ga0068863_100084256 | 3300005841 | Unclassified | 3013 |
| 24 | Ga0070717_10009925 | 3300006028 | Bacteria | 7165 |
| 25 | Ga0075365_10016322 | 3300006038 | Bacteria | 4515 |
| 26 | Ga0075365_10061056 | 3300006038 | Bacteria | 2516 |
| 27 | Ga0075365_10235681 | 3300006038 | Bacteria | 1285 |
| 28 | Ga0075365_10466957 | 3300006038 | Bacteria | 891 |
| 29 | Ga0075363_100285631 | 3300006048 | Bacteria | 955 |
| 30 | Ga0075363_100368623 | 3300006048 | Bacteria | 841 |
| 31 | Ga0075364_10230852 | 3300006051 | Bacteria | 1256 |
| 32 | Ga0070715_10005199 | 3300006163 | Bacteria | 4325 |
| 33 | Ga0070716_100157617 | 3300006173 | Bacteria | 1467 |
| 34 | Ga0097621_101997505 | 3300006237 | Unclassified | 554 |
| 35 | Ga0075370_10391335 | 3300006353 | Unclassified | 833 |
| 36 | Ga0075435_100108094 | 3300007076 | Bacteria | 2311 |
| 37 | Ga0114129_12237907 | 3300009147 | Bacteria | 657 |
| 38 | Ga0105241_10057309 | 3300009174 | Bacteria | 2988 |
| 39 | Ga0157370_10857361 | 3300013104 | Bacteria | 825 |
| 40 | Ga0157378_12441033 | 3300013297 | Bacteria | 575 |
| 41 | Ga0157372_10441204 | 3300013307 | Bacteria | 1517 |
| 42 | Ga0157376_10004722 | 3300014969 | Bacteria | 9493 |
| 43 | Ga0163161_10111721 | 3300017792 | Bacteria | 2044 |
| 44 | Ga0207692_10362254 | 3300025898 | Bacteria | 896 |
| 45 | Ga0207643_10164092 | 3300025908 | Bacteria | 1338 |
| 46 | Ga0207643_10206319 | 3300025908 | Bacteria | 1198 |
| 47 | Ga0207654_10775204 | 3300025911 | Bacteria | 692 |
| 48 | Ga0207663_10014333 | 3300025916 | Bacteria | 4335 |
| 49 | Ga0207652_10347565 | 3300025921 | Bacteria | 1339 |
| 50 | Ga0207652_11021063 | 3300025921 | Bacteria | 726 |
| 51 | Ga0207664_10033907 | 3300025929 | Bacteria | 3928 |
| 52 | Ga0207690_10824038 | 3300025932 | Bacteria | 767 |
| 53 | Ga0207665_10001319 | 3300025939 | Bacteria | 16733 |
| 54 | Ga0207691_10402628 | 3300025940 | Bacteria | 1167 |
| 55 | Ga0207679_10946267 | 3300025945 | Unclassified | 789 |
| 56 | Ga0207639_10290702 | 3300026041 | Unclassified | 1441 |
| 57 | Ga0207678_10010343 | 3300026067 | Bacteria | 8189 |
| 58 | Ga0207708_10450473 | 3300026075 | Bacteria | 1072 |
| 59 | Ga0207702_10937834 | 3300026078 | Bacteria | 858 |
| 60 | Ga0207683_10023388 | 3300026121 | Bacteria | 5315 |
| 61 | Ga0209968_1001748 | 3300027526 | Bacteria | 3290 |
| 62 | Ga0265331_10017486 | 3300031250 | Unclassified | 3737 |
| 63 | Ga0265327_10000726 | 3300031251 | Bacteria | 51653 |
| 64 | Ga0307416_101855136 | 3300032002 | Bacteria | 706 |
| 65 | Ga0307415_100046107 | 3300032126 | Bacteria | 2927 |
| 66 | Ga0373930_0076687 | 3300034816 | Bacteria | 767 |
| 67 | Ga0373929_0222156 | 3300035085 | Bacteria | 538 |
| 68 | Ga0373931_0053852 | 3300035691 | Bacteria | 2148 |
| 69 | Ga0373931_0107994 | 3300035691 | Bacteria | 1574 |
| 70 | Ga0373935_1281110 | 3300035692 | Bacteria | 547 |
| 71 | Ga0373937_0727100 | 3300036401 | Unclassified | 940 |
| 72 | Ga0395900_0636416 | 3300037418 | Bacteria | 1004 |
| 73 | Ga0395905_0014670 | 3300037471 | Bacteria | 7475 |
| 74 | Ga0451837_1214336 | 3300041494 | Bacteria | 1681 |
| 75 | Ga0451855_0864791 | 3300041511 | Bacteria | 2447 |
| 76 | Ga0451855_1865371 | 3300041511 | Bacteria | 3488 |
| 77 | Ga0451577_0000249 | 3300042876 | Bacteria | 106109 |
| 78 | Ga0451577_0017311 | 3300042876 | Bacteria | 6661 |
| 79 | Ga0451577_0063385 | 3300042876 | Bacteria | 3297 |
| 80 | Ga0451577_0076184 | 3300042876 | Unclassified | 2991 |
| 81 | Ga0451577_0554843 | 3300042876 | Bacteria | 1043 |
| 82 | Ga0453683_0008430 | 3300044673 | Bacteria | 6912 |
| 83 | Ga0453683_0030131 | 3300044673 | Bacteria | 3431 |
| 84 | Ga0466963_0265357 | 3300044694 | Bacteria | 1206 |
| 85 | Ga0466964_0043067 | 3300044706 | Bacteria | 1830 |
| 86 | Ga0453684_0022708 | 3300044712 | Bacteria | 9295 |
| 87 | Ga0453684_0053433 | 3300044712 | Bacteria | 5273 |
| 88 | Ga0453684_0109452 | 3300044712 | Bacteria | 3361 |
| 89 | Ga0453684_0126318 | 3300044712 | Bacteria | 3077 |
| 90 | Ga0453684_0201083 | 3300044712 | Bacteria | 2322 |
| 91 | Ga0453684_0543430 | 3300044712 | Unclassified | 1281 |
| 92 | Ga0451576_0000644 | 3300045051 | Bacteria | 72113 |
| 93 | Ga0451576_0001015 | 3300045051 | Bacteria | 51898 |
| 94 | Ga0451576_0014403 | 3300045051 | Bacteria | 8804 |
| 95 | Ga0451576_0017127 | 3300045051 | Bacteria | 7971 |
| 96 | Ga0466967_0162911 | 3300045976 | Bacteria | 2094 |
| 97 | Ga0495607_0105883 | 3300046501 | Bacteria | 1498 |
| 98 | Ga0495607_0316762 | 3300046501 | Unclassified | 729 |
| 99 | Ga0495645_0026201 | 3300046543 | Bacteria | 4231 |
| 100 | Ga0496100_0035238 | 3300048903 | Bacteria | 3146 |
| 101 | Ga0496101_0123387 | 3300048904 | Bacteria | 1960 |
| 102 | Ga0496105_0099668 | 3300048908 | Bacteria | 2399 |
| 103 | Ga0496106_0068221 | 3300048909 | Bacteria | 2712 |
| 104 | Ga0496107_0089745 | 3300048910 | Bacteria | 2244 |
| 105 | Ga0496110_0949911 | 3300048913 | Bacteria | 766 |
| 106 | Ga0496111_0029326 | 3300048914 | Bacteria | 3907 |
| 107 | Ga0496112_0095797 | 3300048915 | Bacteria | 2938 |
| 108 | Ga0501031_0027114 | 3300049568 | Bacteria | 3734 |
| 109 | Ga0501032_0051961 | 3300049569 | Bacteria | 2762 |
| 110 | Ga0501034_0239632 | 3300049571 | Bacteria | 1760 |
| 111 | Ga0501034_0276345 | 3300049571 | Bacteria | 1619 |
| 112 | Ga0501036_0032416 | 3300049572 | Bacteria | 4414 |
| 113 | Ga0501036_0180189 | 3300049572 | Bacteria | 1779 |
| 114 | Ga0501036_0921266 | 3300049572 | Bacteria | 717 |
| 115 | Ga0501038_0036670 | 3300049574 | Bacteria | 4302 |
| 116 | Ga0501041_0182721 | 3300049577 | Bacteria | 1313 |
| 117 | Ga0501042_0146283 | 3300049578 | Bacteria | 1704 |
| 118 | Ga0501043_0241531 | 3300049579 | Bacteria | 1393 |
| 119 | Ga0501046_0474370 | 3300049580 | Bacteria | 898 |
| 120 | Ga0501047_0309911 | 3300049581 | Bacteria | 1419 |
| 121 | Ga0501068_0183293 | 3300049584 | Bacteria | 1324 |
| 122 | Ga0501072_0138082 | 3300049588 | Bacteria | 1944 |
| 123 | Ga0501077_0111691 | 3300049593 | Bacteria | 1732 |
| 124 | Ga0501079_0386859 | 3300049741 | Bacteria | 1097 |
| 125 | Ga0501080_0191383 | 3300049742 | Bacteria | 1880 |
| 126 | Ga0501083_0682399 | 3300049744 | Bacteria | 668 |
| 127 | Ga0501035_0338555 | 3300049822 | Bacteria | 1261 |
| 128 | Ga0501035_0350516 | 3300049822 | Bacteria | 1235 |
| 129 | Ga0501044_0004089 | 3300049823 | Bacteria | 16365 |
| 130 | Ga0501044_0080440 | 3300049823 | Bacteria | 3301 |
| 131 | nmdc:mga03n38_683029_c1 | 3300050490 | Bacteria | 591 |
| 132 | nmdc:mga00v17_300292_c1 | 3300050491 | Bacteria | 1043 |
| 133 | nmdc:mga00v17_50203_c1 | 3300050491 | Bacteria | 2533 |
| 134 | nmdc:mga0yw44_118851_c1 | 3300050492 | Bacteria | 1701 |
| 135 | nmdc:mga0yw44_261754_c1 | 3300050492 | Bacteria | 1153 |
| 136 | nmdc:mga0yw44_413199_c1 | 3300050492 | Bacteria | 913 |
| 137 | nmdc:mga07m45_487462_c1 | 3300050496 | Unclassified | 714 |
| 138 | nmdc:mga07m45_81458_c1 | 3300050496 | Bacteria | 1003 |
| 139 | nmdc:mga05p37_1197492_c1 | 3300050507 | Bacteria | 785 |
| 140 | Ga0500554_017506 | 3300053102 | Bacteria | 1916 |
| 141 | Ga0501082_0108666 | 3300060353 | Bacteria | 2400 |
| 142 | 2540607641 | 2540341094 | Bacteria | 4061186 |
| 143 | 2809055596 | 2808606399 | Bacteria | 4021018 |
| 144 | 2860840410 | 2860837431 | Bacteria | 4202080 |
| 145 | 2958513908 | 2958512119 | Bacteria | 4528530 |
| 146 | 2962293612 | 2962290636 | Bacteria | 4072939 |
| 147 | 2965323776 | 2965320100 | Bacteria | 3975600 |
| 148 | 2969139617 | 2969136845 | Bacteria | 3923176 |
| 149 | 2969767659 | 2969765954 | Bacteria | 4216713 |
| 150 | 2969773031 | 2969770375 | Bacteria | 4271280 |
| 151 | 2980495403 | 2980492589 | Bacteria | 4072961 |
| 152 | 8022654579 | 8022653035 | Bacteria | 4035078 |
| 153 | Ga0070711_101451348 | |||
| 154 | rootL2_10000104 | |||
| 155 | Ga0055532_1025117 | |||
| 156 | Ga0070670_100576893 | |||
| 157 | Ga0070680_100201408 | |||
| 158 | Ga0070682_100015024 | |||
| 159 | Ga0070674_100374715 | |||
| 160 | Ga0070709_10003184 | |||
| 161 | Ga0070713_100241344 | |||
| 162 | Ga0070710_10254845 | |||
| 163 | Ga0070663_100018230 | |||
| 164 | Ga0070678_100052207 | |||
| 165 | Ga0070681_10112526 | |||
| 166 | Ga0070685_10261968 | |||
| 167 | Ga0070679_100149392 | |||
| 168 | Ga0068853_100144485 | |||
| 169 | Ga0070696_100153073 | |||
| 170 | Ga0070664_100933392 | |||
| 171 | Ga0068856_100275281 | |||
| 172 | Ga0070702_100339356 | |||
| 173 | Ga0068859_100738512 | |||
| 174 | Ga0068870_10077476 | |||
| 175 | Ga0068863_100084256 | |||
| 176 | Ga0070717_10009925 | |||
| 177 | Ga0075365_10016322 | |||
| 178 | Ga0075365_10061056 | |||
| 179 | Ga0075365_10235681 | |||
| 180 | Ga0075365_10466957 | |||
| 181 | Ga0075363_100285631 | |||
| 182 | Ga0075363_100368623 | |||
| 183 | Ga0075364_10230852 | |||
| 184 | Ga0070715_10005199 | |||
| 185 | Ga0070716_100157617 | |||
| 186 | Ga0097621_101997505 | |||
| 187 | Ga0075370_10391335 | |||
| 188 | Ga0075435_100108094 | |||
| 189 | Ga0114129_12237907 | |||
| 190 | Ga0105241_10057309 | |||
| 191 | Ga0157370_10857361 | |||
| 192 | Ga0157378_12441033 | |||
| 193 | Ga0157372_10441204 | |||
| 194 | Ga0157376_10004722 | |||
| 195 | Ga0163161_10111721 | |||
| 196 | Ga0207692_10362254 | |||
| 197 | Ga0207643_10164092 | |||
| 198 | Ga0207643_10206319 | |||
| 199 | Ga0207654_10775204 | |||
| 200 | Ga0207663_10014333 | |||
| 201 | Ga0207652_10347565 | |||
| 202 | Ga0207652_11021063 | |||
| 203 | Ga0207664_10033907 | |||
| 204 | Ga0207690_10824038 | |||
| 205 | Ga0207665_10001319 | |||
| 206 | Ga0207691_10402628 | |||
| 207 | Ga0207679_10946267 | |||
| 208 | Ga0207639_10290702 | |||
| 209 | Ga0207678_10010343 | |||
| 210 | Ga0207708_10450473 | |||
| 211 | Ga0207702_10937834 | |||
| 212 | Ga0207683_10023388 | |||
| 213 | Ga0209968_1001748 | |||
| 214 | Ga0265331_10017486 | |||
| 215 | Ga0265327_10000726 | |||
| 216 | Ga0307416_101855136 | |||
| 217 | Ga0307415_100046107 | |||
| 218 | Ga0373930_0076687 | |||
| 219 | Ga0373929_0222156 | |||
| 220 | Ga0373931_0053852 | |||
| 221 | Ga0373931_0107994 | |||
| 222 | Ga0373935_1281110 | |||
| 223 | Ga0373937_0727100 | |||
| 224 | Ga0395900_0636416 | |||
| 225 | Ga0395905_0014670 | |||
| 226 | Ga0451837_1214336 | |||
| 227 | Ga0451855_0864791 | |||
| 228 | Ga0451855_1865371 | |||
| 229 | Ga0451577_0000249 | |||
| 230 | Ga0451577_0017311 | |||
| 231 | Ga0451577_0063385 | |||
| 232 | Ga0451577_0076184 | |||
| 233 | Ga0451577_0554843 | |||
| 234 | Ga0453683_0008430 | |||
| 235 | Ga0453683_0030131 | |||
| 236 | Ga0466963_0265357 | |||
| 237 | Ga0466964_0043067 | |||
| 238 | Ga0453684_0022708 | |||
| 239 | Ga0453684_0053433 | |||
| 240 | Ga0453684_0109452 | |||
| 241 | Ga0453684_0126318 | |||
| 242 | Ga0453684_0201083 | |||
| 243 | Ga0453684_0543430 | |||
| 244 | Ga0451576_0000644 | |||
| 245 | Ga0451576_0001015 | |||
| 246 | Ga0451576_0014403 | |||
| 247 | Ga0451576_0017127 | |||
| 248 | Ga0466967_0162911 | |||
| 249 | Ga0495607_0105883 | |||
| 250 | Ga0495607_0316762 | |||
| 251 | Ga0495645_0026201 | |||
| 252 | Ga0496100_0035238 | |||
| 253 | Ga0496101_0123387 | |||
| 254 | Ga0496105_0099668 | |||
| 255 | Ga0496106_0068221 | |||
| 256 | Ga0496107_0089745 | |||
| 257 | Ga0496110_0949911 | |||
| 258 | Ga0496111_0029326 | |||
| 259 | Ga0496112_0095797 | |||
| 260 | Ga0501031_0027114 | |||
| 261 | Ga0501032_0051961 | |||
| 262 | Ga0501034_0239632 | |||
| 263 | Ga0501034_0276345 | |||
| 264 | Ga0501036_0032416 | |||
| 265 | Ga0501036_0180189 | |||
| 266 | Ga0501036_0921266 | |||
| 267 | Ga0501038_0036670 | |||
| 268 | Ga0501041_0182721 | |||
| 269 | Ga0501042_0146283 | |||
| 270 | Ga0501043_0241531 | |||
| 271 | Ga0501046_0474370 | |||
| 272 | Ga0501047_0309911 | |||
| 273 | Ga0501068_0183293 | |||
| 274 | Ga0501072_0138082 | |||
| 275 | Ga0501077_0111691 | |||
| 276 | Ga0501079_0386859 | |||
| 277 | Ga0501080_0191383 | |||
| 278 | Ga0501083_0682399 | |||
| 279 | Ga0501035_0338555 | |||
| 280 | Ga0501035_0350516 | |||
| 281 | Ga0501044_0004089 | |||
| 282 | Ga0501044_0080440 | |||
| 283 | nmdc:mga03n38_683029_c1 | |||
| 284 | nmdc:mga00v17_300292_c1 | |||
| 285 | nmdc:mga00v17_50203_c1 | |||
| 286 | nmdc:mga0yw44_118851_c1 | |||
| 287 | nmdc:mga0yw44_261754_c1 | |||
| 288 | nmdc:mga0yw44_413199_c1 | |||
| 289 | nmdc:mga07m45_487462_c1 | |||
| 290 | nmdc:mga07m45_81458_c1 | |||
| 291 | nmdc:mga05p37_1197492_c1 | |||
| 292 | Ga0500554_017506 | |||
| 293 | Ga0501082_0108666 | |||
| 294 | 2540607641 | |||
| 295 | 2809055596 | |||
| 296 | 2860840410 | |||
| 297 | 2958513908 | |||
| 298 | 2962293612 | |||
| 299 | 2965323776 | |||
| 300 | 2969139617 | |||
| 301 | 2969767659 | |||
| 302 | 2969773031 | |||
| 303 | 2980495403 | |||
| 304 | 8022654579 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1j7g-assembly1.cif.gz_A-2 | structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase | 0.9614 | 1 | 160 |
| 1jke-assembly1.cif.gz_A | d-tyr trnatyr deacylase from escherichia coli | 0.9562 | 1 | 159 |
| 2dbo-assembly1.cif.gz_A-2 | crystal structure of d-tyr-trna(tyr) deacylase from aquifex aeolicus | 0.9557 | 1 | 162 |
| 1j7g-assembly1.cif.gz_A-2 | structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase | 0.9485 | 1 | 160 |
| 3lmv-assembly3.cif.gz_F | d-tyr-trna(tyr) deacylase from plasmodium falciparum in complex with hepes | 0.9431 | 1 | 162 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXU2_1_149_3.50.80.10 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9649 | 1 | 160 | 3.50.80.10 |
| 1j7gA00 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9614 | 1 | 160 | 3.50.80.10 |
| 2dboA00 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9557 | 1 | 162 | 3.50.80.10 |
| 1j7gA00 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9485 | 1 | 160 | 3.50.80.10 |
| af_Q07648_1_150_3.50.80.10 | Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase | 0.9451 | 1 | 162 | 3.50.80.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q1ATQ8-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) | 0.9888 | 1 | 160 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
| AF-A0A132P4S2-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 0.9879 | 1 | 162 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
| AF-A0A1V5TTS5-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 0.9868 | 1 | 164 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
| AF-A0A651G0J7-F1-model_v4 | D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) | 0.9852 | 1 | 165 |
GO:0000049
GO:0005737 GO:0019478 GO:0043908 GO:0051500 GO:0106026 |
| AF-R6WJP5-F1-model_v4 | D-tyrosyl-tRNA(Tyr) deacylase | 0.985 | 1 | 163 |
GO:0000049
GO:0005737 GO:0051500 |