F213614

General Info

Members Datasets Scaffolds Average Seq Length
152 70 304 193

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100719680|Ga0070714_1007196802
Length 212
Sequence MSRSAISAPPRTRAEMAEQLLIPTRERLLRSAQQLIEEGGYGAASVVAIADRAGVAAGTLYRHFPSKQELFVEVFRAVCAREERAMRQAAEDMSSQPAPDRLQVVLATFAERALRNPRLAWALIAEPVDPLVDAERLAYRERYAQVIAETLRAGITAGELPEQNVELTAAALVGGCGEALVGPLSPVSGQRPSSEEVVDALRTFVRRAVGAE

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
3 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
4 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
5 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
6 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
7 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
8 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
9 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
10 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
11 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
12 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
13 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
18 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
19 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
20 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
21 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
22 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
23 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
24 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
25 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
26 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
27 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
28 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
29 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
30 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
31 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
32 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
33 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
34 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
35 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
36 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
37 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
38 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
39 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
40 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
41 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
42 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
43 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
44 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
45 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
46 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
47 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
48 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
49 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
50 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
51 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
52 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
53 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
54 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
55 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
56 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
57 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
58 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
59 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
60 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
61 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
62 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
63 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
64 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
65 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
66 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
67 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
68 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
69 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
70 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 4.61
Rhizosphere 75.66
Stem 0
Stem Tuber 0
Unclassified 1.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100719680 3300005435 Bacteria 964
2 Ga0070709_10670194 3300005434 Bacteria 805
3 Ga0070714_100011123 3300005435 Bacteria 7132
4 Ga0070714_100037894 3300005435 Bacteria 4053
5 Ga0070714_100162936 3300005435 Bacteria 2019
6 Ga0070714_100163787 3300005435 Bacteria 2014
7 Ga0070714_100165059 3300005435 Bacteria 2006
8 Ga0070714_100271467 3300005435 Bacteria 1573
9 Ga0070713_100220709 3300005436 Bacteria 1719
10 Ga0070713_100356973 3300005436 Bacteria 1357
11 Ga0070713_100404817 3300005436 Bacteria 1275
12 Ga0070713_100598192 3300005436 Bacteria 1047
13 Ga0070711_100063956 3300005439 Bacteria 2569
14 Ga0070717_10013996 3300006028 Bacteria 6162
15 Ga0070717_10228581 3300006028 Bacteria 1637
16 Ga0070717_10344760 3300006028 Bacteria 1331
17 Ga0070715_10099573 3300006163 Bacteria 1353
18 Ga0070712_100052881 3300006175 Bacteria 2834
19 Ga0213874_10000287 3300021377 Bacteria 9893
20 Ga0213876_10084902 3300021384 Bacteria 1675
21 Ga0213876_10262866 3300021384 Bacteria 917
22 Ga0213876_10350398 3300021384 Bacteria 785
23 Ga0213875_10014268 3300021388 Bacteria 3880
24 Ga0213875_10069678 3300021388 Bacteria 1642
25 Ga0213875_10277107 3300021388 Bacteria 792
26 Ga0207699_10503703 3300025906 Bacteria 874
27 Ga0207699_10504522 3300025906 Bacteria 873
28 Ga0207693_10025639 3300025915 Bacteria 4673
29 Ga0207663_10073553 3300025916 Bacteria 2212
30 Ga0207700_10032063 3300025928 Bacteria 3742
31 Ga0207700_10477852 3300025928 Bacteria 1101
32 Ga0207700_10497284 3300025928 Bacteria 1079
33 Ga0207664_10002318 3300025929 Bacteria 12574
34 Ga0207664_10025610 3300025929 Bacteria 4448
35 Ga0207664_10166297 3300025929 Bacteria 1885
36 Ga0207664_10305443 3300025929 Bacteria 1401
37 Ga0207664_10532117 3300025929 Bacteria 1054
38 Ga0207664_10616918 3300025929 Bacteria 974
39 Ga0207665_10231486 3300025939 Bacteria 1358
40 Ga0373953_0053348 3300035117 Bacteria 1639
41 Ga0373954_0090308 3300035118 Bacteria 1471
42 Ga0373957_0104591 3300035120 Bacteria 1136
43 Ga0373937_0010300 3300036401 Bacteria 8160
44 Ga0436364_0448776 3300037853 Bacteria 7078
45 Ga0436364_0581069 3300037853 Bacteria 3167
46 Ga0436364_0752648 3300037853 Bacteria 1216
47 Ga0436364_0757235 3300037853 Bacteria 1436
48 Ga0436364_0930707 3300037853 Bacteria 1305
49 Ga0436364_0988342 3300037853 Bacteria 1362
50 Ga0436364_1141650 3300037853 Bacteria 923
51 Ga0436364_1198619 3300037853 Bacteria 1760
52 Ga0436364_1289782 3300037853 Bacteria 22140
53 Ga0436364_1500764 3300037853 Bacteria 7154
54 Ga0436365_0244127 3300039437 Bacteria 3412
55 Ga0436365_0374094 3300039437 Bacteria 6745
56 Ga0436365_0463000 3300039437 Bacteria 928
57 Ga0436365_0545505 3300039437 Bacteria 4575
58 Ga0436365_0858385 3300039437 Bacteria 3706
59 Ga0436365_0960175 3300039437 Bacteria 14094
60 Ga0436365_1367273 3300039437 Bacteria 1767
61 Ga0436365_1543168 3300039437 Bacteria 2566
62 Ga0436365_1814366 3300039437 Bacteria 1561
63 Ga0436360_0144220 3300039438 Bacteria 4090
64 Ga0436363_0585533 3300039450 Bacteria 2729
65 Ga0436363_1003420 3300039450 Bacteria 1500
66 Ga0436363_1418111 3300039450 Bacteria 38564
67 Ga0436362_0038342 3300039453 Bacteria 1032
68 Ga0436362_0402702 3300039453 Bacteria 1720
69 Ga0466969_0064389 3300044656 Bacteria 1775
70 Ga0466965_0251724 3300044683 Bacteria 948
71 Ga0466966_0031082 3300044684 Bacteria 3463
72 Ga0466966_0099546 3300044684 Bacteria 1799
73 Ga0466966_0317043 3300044684 Bacteria 937
74 Ga0466961_0034142 3300044693 Bacteria 3266
75 Ga0466961_0067627 3300044693 Bacteria 2269
76 Ga0466961_0083157 3300044693 Bacteria 2024
77 Ga0466961_0202549 3300044693 Bacteria 1227
78 Ga0466961_0236744 3300044693 Bacteria 1123
79 Ga0466961_0292390 3300044693 Bacteria 996
80 Ga0466963_0028466 3300044694 Bacteria 3587
81 Ga0466963_0033909 3300044694 Bacteria 3319
82 Ga0466963_0089401 3300044694 Bacteria 2095
83 Ga0466963_0129760 3300044694 Bacteria 1740
84 Ga0466963_0388939 3300044694 Bacteria 983
85 Ga0466971_0007179 3300044719 Bacteria 4850
86 Ga0466971_0025359 3300044719 Bacteria 2647
87 Ga0466971_0102199 3300044719 Bacteria 1318
88 Ga0466968_0042773 3300044735 Bacteria 1916
89 Ga0466968_0185390 3300044735 Unclassified 969
90 Ga0466968_0218281 3300044735 Bacteria 897
91 Ga0466970_0193276 3300044765 Bacteria 1131
92 Ga0466957_0008968 3300044842 Bacteria 5702
93 Ga0466957_0020094 3300044842 Bacteria 3931
94 Ga0466957_0063068 3300044842 Bacteria 2277
95 Ga0466959_0000656 3300045049 Bacteria 20183
96 Ga0466959_0012930 3300045049 Bacteria 6042
97 Ga0466959_0018142 3300045049 Bacteria 5164
98 Ga0466959_0042309 3300045049 Bacteria 3360
99 Ga0466959_0286529 3300045049 Bacteria 1130
100 Ga0466959_0311000 3300045049 Bacteria 1078
101 Ga0466959_0338419 3300045049 Bacteria 1027
102 Ga0466958_0015121 3300045836 Bacteria 4416
103 Ga0466958_0016716 3300045836 Bacteria 4230
104 Ga0466958_0127607 3300045836 Bacteria 1595
105 Ga0466958_0190318 3300045836 Bacteria 1304
106 Ga0466958_0236151 3300045836 Bacteria 1168
107 Ga0466958_0239914 3300045836 Bacteria 1158
108 Ga0466967_0015680 3300045976 Bacteria 5950
109 Ga0466967_0139653 3300045976 Bacteria 2256
110 Ga0466967_0155223 3300045976 Bacteria 2143
111 Ga0466967_0254399 3300045976 Bacteria 1679
112 Ga0466967_0827690 3300045976 Bacteria 920
113 Ga0495629_0248558 3300046459 Bacteria 1224
114 Ga0495641_0002216 3300046461 Bacteria 15495
115 Ga0495651_0076351 3300046462 Bacteria 2538
116 Ga0495582_0055056 3300046473 Bacteria 2193
117 Ga0495662_0032123 3300046476 Bacteria 2536
118 Ga0495596_0212942 3300046500 Bacteria 750
119 Ga0495608_0022032 3300046511 Bacteria 4368
120 Ga0495616_0139989 3300046513 Bacteria 1102
121 Ga0495628_0078636 3300046516 Bacteria 2565
122 Ga0495630_0319121 3300046517 Bacteria 1188
123 Ga0495630_0924624 3300046517 Bacteria 664
124 Ga0495631_0082400 3300046518 Bacteria 1387
125 Ga0495665_0294978 3300046531 Unclassified 831
126 Ga0495656_0013068 3300046615 Bacteria 3079
127 Ga0495635_0051815 3300046663 Bacteria 2827
128 Ga0495635_0338603 3300046663 Bacteria 1005
129 Ga0495657_0059579 3300046675 Bacteria 2532
130 Ga0495646_0019381 3300046680 Bacteria 4308
131 Ga0495604_0364373 3300047317 Bacteria 958
132 Ga0495674_0195995 3300047319 Bacteria 1677
133 Ga0495676_0328567 3300047321 Bacteria 1026
134 Ga0495680_0334508 3300047322 Bacteria 1057
135 Ga0495675_0149041 3300047444 Bacteria 1446
136 Ga0495675_0333212 3300047444 Bacteria 896
137 Ga0495684_0630324 3300047471 Bacteria 720
138 Ga0495686_0000003 3300047472 Bacteria 899502
139 Ga0495686_0044476 3300047472 Bacteria 2811
140 Ga0495686_0046799 3300047472 Bacteria 2733
141 Ga0495602_0123330 3300048088 Bacteria 2080
142 Ga0496104_0073608 3300048907 Bacteria 3250
143 Ga0496105_0398824 3300048908 Bacteria 1092
144 Ga0496109_0408464 3300048912 Bacteria 1283
145 Ga0496110_0125102 3300048913 Bacteria 2319
146 Ga0496112_0010269 3300048915 Bacteria 8488
147 Ga0496115_0061693 3300048918 Bacteria 3023
148 Ga0496115_0069585 3300048918 Bacteria 2851
149 nmdc:mga0rr50_184354_c1 3300050513 Bacteria 1707
150 Ga0500628_009331 3300053129 Bacteria 1728
151 Ga0466962_0013943 3300061719 Bacteria 3872
152 Ga0466962_0015854 3300061719 Bacteria 3636
153 Ga0070714_100719680
154 Ga0070709_10670194
155 Ga0070714_100011123
156 Ga0070714_100037894
157 Ga0070714_100162936
158 Ga0070714_100163787
159 Ga0070714_100165059
160 Ga0070714_100271467
161 Ga0070713_100220709
162 Ga0070713_100356973
163 Ga0070713_100404817
164 Ga0070713_100598192
165 Ga0070711_100063956
166 Ga0070717_10013996
167 Ga0070717_10228581
168 Ga0070717_10344760
169 Ga0070715_10099573
170 Ga0070712_100052881
171 Ga0213874_10000287
172 Ga0213876_10084902
173 Ga0213876_10262866
174 Ga0213876_10350398
175 Ga0213875_10014268
176 Ga0213875_10069678
177 Ga0213875_10277107
178 Ga0207699_10503703
179 Ga0207699_10504522
180 Ga0207693_10025639
181 Ga0207663_10073553
182 Ga0207700_10032063
183 Ga0207700_10477852
184 Ga0207700_10497284
185 Ga0207664_10002318
186 Ga0207664_10025610
187 Ga0207664_10166297
188 Ga0207664_10305443
189 Ga0207664_10532117
190 Ga0207664_10616918
191 Ga0207665_10231486
192 Ga0373953_0053348
193 Ga0373954_0090308
194 Ga0373957_0104591
195 Ga0373937_0010300
196 Ga0436364_0448776
197 Ga0436364_0581069
198 Ga0436364_0752648
199 Ga0436364_0757235
200 Ga0436364_0930707
201 Ga0436364_0988342
202 Ga0436364_1141650
203 Ga0436364_1198619
204 Ga0436364_1289782
205 Ga0436364_1500764
206 Ga0436365_0244127
207 Ga0436365_0374094
208 Ga0436365_0463000
209 Ga0436365_0545505
210 Ga0436365_0858385
211 Ga0436365_0960175
212 Ga0436365_1367273
213 Ga0436365_1543168
214 Ga0436365_1814366
215 Ga0436360_0144220
216 Ga0436363_0585533
217 Ga0436363_1003420
218 Ga0436363_1418111
219 Ga0436362_0038342
220 Ga0436362_0402702
221 Ga0466969_0064389
222 Ga0466965_0251724
223 Ga0466966_0031082
224 Ga0466966_0099546
225 Ga0466966_0317043
226 Ga0466961_0034142
227 Ga0466961_0067627
228 Ga0466961_0083157
229 Ga0466961_0202549
230 Ga0466961_0236744
231 Ga0466961_0292390
232 Ga0466963_0028466
233 Ga0466963_0033909
234 Ga0466963_0089401
235 Ga0466963_0129760
236 Ga0466963_0388939
237 Ga0466971_0007179
238 Ga0466971_0025359
239 Ga0466971_0102199
240 Ga0466968_0042773
241 Ga0466968_0185390
242 Ga0466968_0218281
243 Ga0466970_0193276
244 Ga0466957_0008968
245 Ga0466957_0020094
246 Ga0466957_0063068
247 Ga0466959_0000656
248 Ga0466959_0012930
249 Ga0466959_0018142
250 Ga0466959_0042309
251 Ga0466959_0286529
252 Ga0466959_0311000
253 Ga0466959_0338419
254 Ga0466958_0015121
255 Ga0466958_0016716
256 Ga0466958_0127607
257 Ga0466958_0190318
258 Ga0466958_0236151
259 Ga0466958_0239914
260 Ga0466967_0015680
261 Ga0466967_0139653
262 Ga0466967_0155223
263 Ga0466967_0254399
264 Ga0466967_0827690
265 Ga0495629_0248558
266 Ga0495641_0002216
267 Ga0495651_0076351
268 Ga0495582_0055056
269 Ga0495662_0032123
270 Ga0495596_0212942
271 Ga0495608_0022032
272 Ga0495616_0139989
273 Ga0495628_0078636
274 Ga0495630_0319121
275 Ga0495630_0924624
276 Ga0495631_0082400
277 Ga0495665_0294978
278 Ga0495656_0013068
279 Ga0495635_0051815
280 Ga0495635_0338603
281 Ga0495657_0059579
282 Ga0495646_0019381
283 Ga0495604_0364373
284 Ga0495674_0195995
285 Ga0495676_0328567
286 Ga0495680_0334508
287 Ga0495675_0149041
288 Ga0495675_0333212
289 Ga0495684_0630324
290 Ga0495686_0000003
291 Ga0495686_0044476
292 Ga0495686_0046799
293 Ga0495602_0123330
294 Ga0496104_0073608
295 Ga0496105_0398824
296 Ga0496109_0408464
297 Ga0496110_0125102
298 Ga0496112_0010269
299 Ga0496115_0061693
300 Ga0496115_0069585
301 nmdc:mga0rr50_184354_c1
302 Ga0500628_009331
303 Ga0466962_0013943
304 Ga0466962_0015854

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

28

74

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cjd-assembly1.cif.gz_B crystal structure of putative tetr transcriptional regulator (yp_510936.1) from jannaschia sp. ccs1 at 1.79 a resolution 0.7473 12 168
6hs1-assembly1.cif.gz_B ethr2 in complex with compound 9 (bdm76060) 0.7427 11 170
3cjd-assembly1.cif.gz_A crystal structure of putative tetr transcriptional regulator (yp_510936.1) from jannaschia sp. ccs1 at 1.79 a resolution 0.7402 11 169
6fts-assembly1.cif.gz_A-2 tetr(d) n82a mutant in complex with peg4 0.7362 8 170
6sy6-assembly1.cif.gz_A tetr in complex with the tetr-binding rna-aptamer k2 0.7356 9 166
ID Description Score Start End Superfamily
2of7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9607 11 51 1.10.10.60
5gpcA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9486 9 53 1.10.10.60
5gpcC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9473 9 53 1.10.10.60
1qpiA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9358 12 70 1.10.10.60
2y30A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9352 12 64 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A6J7G7H3-F1-model_v4 Unannotated protein 0.861 1 173 GO:0000976
GO:0003700
AF-A0A6J7G7H3-F1-model_v4 Unannotated protein 0.8563 1 173 GO:0000976
GO:0003700
AF-A0A839RJ25-F1-model_v4 AcrR family transcriptional regulator 0.848 11 173 GO:0000976
GO:0003700
AF-A0A2W2EQW6-F1-model_v4 HTH tetR-type domain-containing protein 0.7968 2 123 GO:0003677
GO:0006355
AF-A0A839RJ25-F1-model_v4 AcrR family transcriptional regulator 0.7968 11 173 GO:0000976
GO:0003700

Map