F212198

General Info

Members Datasets Scaffolds Average Seq Length
151 80 302 234

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0068183|Ga0436364_0068183_1093_1875
Length 260
Sequence MSSVNRSPASDRERTPGRDRRASRHHRELWVCNLGTVEYREALELQTRLRTARQLDQLPDLLLLLEHPPVYTRGRRSGEGELPMGEDWYRMQRIEIVDCDRGGKVTYHGPGQLVGYPIARIDDVIGYLRALERALVAALTEEGVAARARPEDGPDYTGVWVQQRKIASLGVHVARGVSTHGFAVNVENDLEPFSWIVPCGLDGVRMTSLLEETGRRAPQMKCFRRRVAWHVAEALDRRQRLVSLSRISSQPLALRALAAR

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
3 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
4 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
5 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
6 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
7 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
8 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
9 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
10 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
11 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
12 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
13 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
14 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
15 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
26 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
27 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
28 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
29 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
30 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
31 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
32 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
33 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
34 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
35 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
36 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
37 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
38 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
39 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
40 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
41 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
42 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
43 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
44 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
45 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
46 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
47 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
48 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
49 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
50 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
51 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
52 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
53 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
54 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
55 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
56 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
57 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
58 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
59 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
60 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
61 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
62 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
63 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
64 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
65 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
66 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
67 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
68 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
69 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
70 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
71 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
72 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
73 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
74 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
75 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
76 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
77 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
78 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
79 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
80 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.27
Rhizosphere 70.2
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0068183 3300037853 Bacteria 3364
2 Ga0070714_100102052 3300005435 Bacteria 2528
3 Ga0070714_100157771 3300005435 Bacteria 2050
4 Ga0070713_100037603 3300005436 Bacteria 3914
5 Ga0070713_100191136 3300005436 Bacteria 1845
6 Ga0068856_100574770 3300005614 Bacteria 1148
7 Ga0070717_10028020 3300006028 Bacteria 4506
8 Ga0070717_10058071 3300006028 Bacteria 3199
9 Ga0070715_10259500 3300006163 Bacteria 912
10 Ga0163162_10715294 3300013306 Bacteria 1122
11 Ga0157372_10496076 3300013307 Bacteria 1424
12 Ga0213873_10014468 3300021358 Bacteria 1749
13 Ga0213874_10005658 3300021377 Bacteria 2924
14 Ga0213874_10030363 3300021377 Bacteria 1556
15 Ga0213876_10005499 3300021384 Bacteria 6955
16 Ga0213876_10011227 3300021384 Bacteria 4787
17 Ga0213876_10049685 3300021384 Bacteria 2216
18 Ga0213876_10088440 3300021384 Bacteria 1640
19 Ga0213875_10000272 3300021388 Bacteria 51129
20 Ga0213875_10002539 3300021388 Bacteria 10892
21 Ga0213875_10008285 3300021388 Bacteria 5331
22 Ga0213875_10042185 3300021388 Bacteria 2144
23 Ga0207705_10160287 3300025909 Bacteria 1690
24 Ga0207693_10013149 3300025915 Bacteria 6677
25 Ga0207663_10169013 3300025916 Bacteria 1551
26 Ga0207657_10099214 3300025919 Bacteria 2419
27 Ga0207681_10114228 3300025923 Bacteria 1970
28 Ga0207700_10088211 3300025928 Bacteria 2442
29 Ga0207664_10012515 3300025929 Bacteria 6071
30 Ga0207665_10138618 3300025939 Bacteria 1733
31 Ga0207665_10165059 3300025939 Bacteria 1596
32 Ga0207679_10482161 3300025945 Bacteria 1104
33 Ga0207668_10278474 3300025972 Bacteria 1371
34 Ga0207640_10203783 3300025981 Bacteria 1501
35 Ga0207702_10543188 3300026078 Bacteria 1136
36 Ga0373956_0239164 3300035119 Bacteria 863
37 Ga0373957_0112426 3300035120 Bacteria 1098
38 Ga0373935_0220955 3300035692 Bacteria 1316
39 Ga0373927_0178245 3300035695 Bacteria 1394
40 Ga0373927_0628476 3300035695 Bacteria 710
41 Ga0373933_0031335 3300035724 Bacteria 3085
42 Ga0373947_0399537 3300035725 Bacteria 927
43 Ga0373937_0023986 3300036401 Bacteria 5500
44 Ga0436364_0049620 3300037853 Bacteria 2691
45 Ga0436364_0052171 3300037853 Bacteria 7668
46 Ga0436364_0153541 3300037853 Bacteria 866
47 Ga0436364_0400031 3300037853 Bacteria 1032
48 Ga0436364_0418048 3300037853 Bacteria 968
49 Ga0436364_0685870 3300037853 Bacteria 43862
50 Ga0436364_1160370 3300037853 Bacteria 4998
51 Ga0436364_1255692 3300037853 Bacteria 1716
52 Ga0436364_1277946 3300037853 Bacteria 1715
53 Ga0436364_1278666 3300037853 Bacteria 5052
54 Ga0436364_1331531 3300037853 Bacteria 2476
55 Ga0436365_0071059 3300039437 Bacteria 14070
56 Ga0436365_0858525 3300039437 Bacteria 5323
57 Ga0436365_1323044 3300039437 Bacteria 5338
58 Ga0436365_1806466 3300039437 Bacteria 2370
59 Ga0436360_1119366 3300039438 Bacteria 4442
60 Ga0436363_0252280 3300039450 Bacteria 4484
61 Ga0436363_0943791 3300039450 Bacteria 942
62 Ga0436363_1042330 3300039450 Unclassified 885
63 Ga0436363_1259518 3300039450 Bacteria 14400
64 Ga0436363_1525407 3300039450 Bacteria 922
65 Ga0436362_0224072 3300039453 Bacteria 2217
66 Ga0436362_1111152 3300039453 Bacteria 1979
67 Ga0466969_0036757 3300044656 Bacteria 2472
68 Ga0466965_0130855 3300044683 Bacteria 1301
69 Ga0466965_0162607 3300044683 Bacteria 1171
70 Ga0466966_0118641 3300044684 Bacteria 1627
71 Ga0466966_0130499 3300044684 Bacteria 1539
72 Ga0466966_0159683 3300044684 Bacteria 1373
73 Ga0466966_0183592 3300044684 Bacteria 1269
74 Ga0466966_0233331 3300044684 Bacteria 1110
75 Ga0466961_0014758 3300044693 Bacteria 5019
76 Ga0466961_0048079 3300044693 Bacteria 2727
77 Ga0466961_0122564 3300044693 Bacteria 1631
78 Ga0466963_0004134 3300044694 Bacteria 8393
79 Ga0466963_0009119 3300044694 Bacteria 5965
80 Ga0466963_0053986 3300044694 Bacteria 2670
81 Ga0466963_0065634 3300044694 Bacteria 2434
82 Ga0466963_0177875 3300044694 Bacteria 1485
83 Ga0466971_0018785 3300044719 Bacteria 3065
84 Ga0466971_0022370 3300044719 Bacteria 2817
85 Ga0466971_0142404 3300044719 Bacteria 1116
86 Ga0466971_0211760 3300044719 Bacteria 917
87 Ga0466968_0022907 3300044735 Bacteria 2541
88 Ga0466968_0077044 3300044735 Bacteria 1460
89 Ga0466968_0160368 3300044735 Bacteria 1038
90 Ga0466970_0100598 3300044765 Bacteria 1574
91 Ga0466970_0166338 3300044765 Bacteria 1221
92 Ga0466957_0001522 3300044842 Bacteria 12191
93 Ga0466957_0043371 3300044842 Bacteria 2724
94 Ga0466957_0187486 3300044842 Bacteria 1353
95 Ga0466959_0016328 3300045049 Bacteria 5423
96 Ga0466959_0062046 3300045049 Bacteria 2717
97 Ga0466959_0292098 3300045049 Bacteria 1117
98 Ga0466959_0341686 3300045049 Bacteria 1021
99 Ga0466959_0415825 3300045049 Bacteria 913
100 Ga0466958_0025042 3300045836 Bacteria 3515
101 Ga0466958_0055768 3300045836 Bacteria 2399
102 Ga0466958_0058300 3300045836 Bacteria 2348
103 Ga0466958_0063040 3300045836 Bacteria 2260
104 Ga0466958_0080188 3300045836 Bacteria 2008
105 Ga0466958_0155577 3300045836 Bacteria 1443
106 Ga0466967_0004282 3300045976 Bacteria 9595
107 Ga0466967_0025101 3300045976 Bacteria 4910
108 Ga0466967_0362679 3300045976 Bacteria 1404
109 Ga0466967_0482984 3300045976 Bacteria 1214
110 Ga0466967_0976563 3300045976 Bacteria 843
111 Ga0495603_0314611 3300046455 Bacteria 899
112 Ga0495651_0024824 3300046462 Bacteria 4663
113 Ga0495653_0173343 3300046463 Bacteria 1487
114 Ga0495584_0175555 3300046491 Bacteria 1089
115 Ga0495628_0054140 3300046516 Bacteria 3164
116 Ga0495652_0183655 3300046529 Bacteria 1602
117 Ga0495652_0320629 3300046529 Bacteria 1120
118 Ga0495586_0373518 3300046535 Bacteria 820
119 Ga0495587_0042294 3300046536 Bacteria 2718
120 Ga0495645_0000091 3300046543 Bacteria 63295
121 Ga0495667_0120929 3300046559 Bacteria 1690
122 Ga0495667_0287795 3300046559 Bacteria 1042
123 Ga0495657_0170503 3300046675 Bacteria 1340
124 Ga0495613_0192225 3300046689 Bacteria 1442
125 Ga0495600_0049698 3300046809 Bacteria 2736
126 Ga0495581_0176322 3300047315 Bacteria 1250
127 Ga0495604_0102824 3300047317 Bacteria 2097
128 Ga0495604_0387397 3300047317 Bacteria 922
129 Ga0495674_0260388 3300047319 Bacteria 1425
130 Ga0495674_0599687 3300047319 Bacteria 873
131 Ga0495680_0070068 3300047322 Bacteria 2674
132 Ga0496102_0015380 3300048905 Bacteria 6665
133 Ga0496104_0173214 3300048907 Bacteria 2068
134 Ga0496105_0025728 3300048908 Bacteria 4794
135 Ga0496106_0098877 3300048909 Bacteria 2261
136 Ga0496108_0001964 3300048911 Bacteria 16463
137 Ga0496109_0004039 3300048912 Bacteria 12254
138 Ga0496109_0185308 3300048912 Bacteria 1956
139 Ga0496110_0744740 3300048913 Bacteria 883
140 Ga0496111_0065044 3300048914 Bacteria 2646
141 Ga0496112_0117547 3300048915 Bacteria 2629
142 Ga0496112_0134873 3300048915 Bacteria 2439
143 Ga0496113_0005502 3300048916 Bacteria 7906
144 Ga0496114_0746792 3300048917 Bacteria 856
145 Ga0496115_0068471 3300048918 Bacteria 2874
146 Ga0495601_0416531 3300053077 Bacteria 870
147 Ga0495595_0029538 3300053084 Bacteria 2454
148 Ga0495619_0174840 3300053085 Bacteria 1485
149 Ga0495619_0522577 3300053085 Bacteria 815
150 Ga0466962_0001611 3300061719 Bacteria 10575
151 Ga0466962_0054295 3300061719 Bacteria 1915
152 Ga0436364_0068183
153 Ga0070714_100102052
154 Ga0070714_100157771
155 Ga0070713_100037603
156 Ga0070713_100191136
157 Ga0068856_100574770
158 Ga0070717_10028020
159 Ga0070717_10058071
160 Ga0070715_10259500
161 Ga0163162_10715294
162 Ga0157372_10496076
163 Ga0213873_10014468
164 Ga0213874_10005658
165 Ga0213874_10030363
166 Ga0213876_10005499
167 Ga0213876_10011227
168 Ga0213876_10049685
169 Ga0213876_10088440
170 Ga0213875_10000272
171 Ga0213875_10002539
172 Ga0213875_10008285
173 Ga0213875_10042185
174 Ga0207705_10160287
175 Ga0207693_10013149
176 Ga0207663_10169013
177 Ga0207657_10099214
178 Ga0207681_10114228
179 Ga0207700_10088211
180 Ga0207664_10012515
181 Ga0207665_10138618
182 Ga0207665_10165059
183 Ga0207679_10482161
184 Ga0207668_10278474
185 Ga0207640_10203783
186 Ga0207702_10543188
187 Ga0373956_0239164
188 Ga0373957_0112426
189 Ga0373935_0220955
190 Ga0373927_0178245
191 Ga0373927_0628476
192 Ga0373933_0031335
193 Ga0373947_0399537
194 Ga0373937_0023986
195 Ga0436364_0049620
196 Ga0436364_0052171
197 Ga0436364_0153541
198 Ga0436364_0400031
199 Ga0436364_0418048
200 Ga0436364_0685870
201 Ga0436364_1160370
202 Ga0436364_1255692
203 Ga0436364_1277946
204 Ga0436364_1278666
205 Ga0436364_1331531
206 Ga0436365_0071059
207 Ga0436365_0858525
208 Ga0436365_1323044
209 Ga0436365_1806466
210 Ga0436360_1119366
211 Ga0436363_0252280
212 Ga0436363_0943791
213 Ga0436363_1042330
214 Ga0436363_1259518
215 Ga0436363_1525407
216 Ga0436362_0224072
217 Ga0436362_1111152
218 Ga0466969_0036757
219 Ga0466965_0130855
220 Ga0466965_0162607
221 Ga0466966_0118641
222 Ga0466966_0130499
223 Ga0466966_0159683
224 Ga0466966_0183592
225 Ga0466966_0233331
226 Ga0466961_0014758
227 Ga0466961_0048079
228 Ga0466961_0122564
229 Ga0466963_0004134
230 Ga0466963_0009119
231 Ga0466963_0053986
232 Ga0466963_0065634
233 Ga0466963_0177875
234 Ga0466971_0018785
235 Ga0466971_0022370
236 Ga0466971_0142404
237 Ga0466971_0211760
238 Ga0466968_0022907
239 Ga0466968_0077044
240 Ga0466968_0160368
241 Ga0466970_0100598
242 Ga0466970_0166338
243 Ga0466957_0001522
244 Ga0466957_0043371
245 Ga0466957_0187486
246 Ga0466959_0016328
247 Ga0466959_0062046
248 Ga0466959_0292098
249 Ga0466959_0341686
250 Ga0466959_0415825
251 Ga0466958_0025042
252 Ga0466958_0055768
253 Ga0466958_0058300
254 Ga0466958_0063040
255 Ga0466958_0080188
256 Ga0466958_0155577
257 Ga0466967_0004282
258 Ga0466967_0025101
259 Ga0466967_0362679
260 Ga0466967_0482984
261 Ga0466967_0976563
262 Ga0495603_0314611
263 Ga0495651_0024824
264 Ga0495653_0173343
265 Ga0495584_0175555
266 Ga0495628_0054140
267 Ga0495652_0183655
268 Ga0495652_0320629
269 Ga0495586_0373518
270 Ga0495587_0042294
271 Ga0495645_0000091
272 Ga0495667_0120929
273 Ga0495667_0287795
274 Ga0495657_0170503
275 Ga0495613_0192225
276 Ga0495600_0049698
277 Ga0495581_0176322
278 Ga0495604_0102824
279 Ga0495604_0387397
280 Ga0495674_0260388
281 Ga0495674_0599687
282 Ga0495680_0070068
283 Ga0496102_0015380
284 Ga0496104_0173214
285 Ga0496105_0025728
286 Ga0496106_0098877
287 Ga0496108_0001964
288 Ga0496109_0004039
289 Ga0496109_0185308
290 Ga0496110_0744740
291 Ga0496111_0065044
292 Ga0496112_0117547
293 Ga0496112_0134873
294 Ga0496113_0005502
295 Ga0496114_0746792
296 Ga0496115_0068471
297 Ga0495601_0416531
298 Ga0495595_0029538
299 Ga0495619_0174840
300 Ga0495619_0522577
301 Ga0466962_0001611
302 Ga0466962_0054295

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21948

LplA-B_cat

Lipoyl protein ligase A/B catalytic domain

38

232

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qhv-assembly1.cif.gz_A structural basis of octanoic acid recognition by lipoate-protein ligase b 0.9398 5 217
2qhv-assembly1.cif.gz_A structural basis of octanoic acid recognition by lipoate-protein ligase b 0.9311 5 217
1w66-assembly1.cif.gz_A structure of a lipoate-protein ligase b from mycobacterium tuberculosis 0.918 6 213
1w66-assembly1.cif.gz_A structure of a lipoate-protein ligase b from mycobacterium tuberculosis 0.8445 6 213
2c7i-assembly3.cif.gz_C structure of protein ta0514, putative lipoate protein ligase from t. acidophilum. 0.7894 5 231
ID Description Score Start End Superfamily
2qhuA01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9393 6 213 3.30.930.10
af_Q9SXP7_6_215_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9368 6 211 3.30.930.10
2qhuA01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9261 6 213 3.30.930.10
af_P60720_2_203_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9217 6 211 3.30.930.10
1w66A01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9181 6 212 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A7W0UTI3-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.9779 1 233 GO:0005737
GO:0033819
AF-A0A538LWP6-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.9669 3 224 GO:0005737
GO:0033819
AF-A0A537Z8N0-F1-model_v4 lipoyl(octanoyl) transferase (EC 2.3.1.181) 0.9626 29 180 GO:0033819
AF-A0A538LAR4-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.9566 4 234 GO:0005737
GO:0033819
AF-A0A524QSV2-F1-model_v4 lipoyl(octanoyl) transferase (EC 2.3.1.181) 0.9539 4 122 GO:0033819

Map