F212189

General Info

Members Datasets Scaffolds Average Seq Length
151 75 302 129

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0605482|Ga0395898_0605482_293_712
Length 139
Sequence MSAAWGKCFDPNGARYGVPTYPWRLAPDGLATRRQLRAQGLRPGGQPIAAQVMRINRRAGSPRVAFLYRIDRALPVRPMTSRKWGALALAMLARRTCPKCRITYGYCMPRSLGMCVLCAYPDTPAPAGARVTDTSPRST

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
4 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
5 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
6 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
7 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
8 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
9 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
10 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
11 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
12 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
13 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
14 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
15 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
16 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
17 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
18 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
19 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
20 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
21 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
22 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
23 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
24 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
25 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
26 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
27 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
28 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
29 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
30 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
31 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
32 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
33 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
34 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
35 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
36 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
37 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
38 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
39 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
40 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
41 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
42 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
43 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
44 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
45 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
46 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
47 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
48 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
49 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
50 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
51 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
52 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
53 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
54 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
55 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
56 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
57 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
58 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
59 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
60 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
61 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
62 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
63 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
64 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
65 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
66 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
67 2862574272 Streptomyces sp. AcE210 Isolate Nodule
68 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
69 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
70 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
71 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
72 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
73 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
74 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
75 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.72
Metatranscriptomes 0
Isolates 7.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.3
Nodule 0.66
Rhizoplane 0.66
Rhizosphere 69.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0605482 3300037466 Bacteria 1038
2 Ga0081455_10233052 3300005937 Bacteria 1357
3 Ga0075363_100564010 3300006048 Bacteria 680
4 Ga0075367_10797839 3300006178 Bacteria 601
5 Ga0075370_10365585 3300006353 Bacteria 863
6 Ga0182008_10085712 3300014497 Bacteria 1551
7 Ga0307517_10011193 3300028786 Bacteria 12451
8 Ga0307515_10367792 3300028794 Bacteria 1076
9 Ga0307515_10515954 3300028794 Bacteria 805
10 Ga0307511_10053764 3300030521 Bacteria 3186
11 Ga0307511_10137173 3300030521 Bacteria 1452
12 Ga0307511_10307508 3300030521 Bacteria 711
13 Ga0307512_10072264 3300030522 Bacteria 2553
14 Ga0307512_10131070 3300030522 Bacteria 1572
15 Ga0307512_10134557 3300030522 Bacteria 1536
16 Ga0307512_10165785 3300030522 Bacteria 1280
17 Ga0307513_10008650 3300031456 Bacteria 12969
18 Ga0307509_10074242 3300031507 Bacteria 3538
19 Ga0307509_10099266 3300031507 Bacteria 2954
20 Ga0307509_10212917 3300031507 Bacteria 1755
21 Ga0307508_10047762 3300031616 Bacteria 3815
22 Ga0307508_10074398 3300031616 Bacteria 2973
23 Ga0307508_10258960 3300031616 Bacteria 1335
24 Ga0307508_10329031 3300031616 Bacteria 1120
25 Ga0307508_10345142 3300031616 Bacteria 1080
26 Ga0307508_10638748 3300031616 Bacteria 669
27 Ga0307514_10001637 3300031649 Bacteria 26124
28 Ga0307514_10036969 3300031649 Bacteria 3876
29 Ga0307514_10388778 3300031649 Bacteria 719
30 Ga0307514_10516722 3300031649 Bacteria 562
31 Ga0307518_10084900 3300031838 Bacteria 2282
32 Ga0307518_10086178 3300031838 Bacteria 2264
33 Ga0307507_10020856 3300033179 Bacteria 7320
34 Ga0307507_10026020 3300033179 Bacteria 6321
35 Ga0307507_10272151 3300033179 Bacteria 1069
36 Ga0307510_10119323 3300033180 Bacteria 2348
37 Ga0307510_10271905 3300033180 Bacteria 1170
38 Ga0451789_1330446 3300041443 Bacteria 671
39 Ga0451853_0501441 3300041512 Bacteria 1280
40 Ga0451853_0684922 3300041512 Bacteria 809
41 Ga0451853_1980521 3300041512 Bacteria 546
42 Ga0451853_2104036 3300041512 Bacteria 537
43 Ga0451853_3270812 3300041512 Bacteria 583
44 Ga0466966_0055674 3300044684 Bacteria 2503
45 Ga0466961_0420359 3300044693 Bacteria 810
46 Ga0466963_0315437 3300044694 Bacteria 1100
47 Ga0466959_0418966 3300045049 Bacteria 909
48 Ga0466958_0411435 3300045836 Bacteria 874
49 Ga0495617_080639 3300046452 Bacteria 1066
50 Ga0495603_0040540 3300046455 Bacteria 2787
51 Ga0495603_0383023 3300046455 Bacteria 806
52 Ga0495603_0852560 3300046455 Bacteria 519
53 Ga0495629_0001710 3300046459 Bacteria 17236
54 Ga0495629_0041390 3300046459 Bacteria 3242
55 Ga0495629_0092202 3300046459 Bacteria 2115
56 Ga0495629_0299513 3300046459 Bacteria 1101
57 Ga0495629_0437006 3300046459 Bacteria 887
58 Ga0495629_0453129 3300046459 Bacteria 868
59 Ga0495651_0601538 3300046462 Bacteria 694
60 Ga0495605_0331767 3300046474 Bacteria 640
61 Ga0495585_0031421 3300046492 Bacteria 3014
62 Ga0495585_0300791 3300046492 Bacteria 789
63 Ga0495594_0643865 3300046499 Bacteria 600
64 Ga0495594_0677062 3300046499 Bacteria 584
65 Ga0495583_0003565 3300046506 Bacteria 11724
66 Ga0495583_0106361 3300046506 Bacteria 1193
67 Ga0495583_0136522 3300046506 Bacteria 1023
68 Ga0495618_0114500 3300046514 Bacteria 1727
69 Ga0495628_0156756 3300046516 Bacteria 1732
70 Ga0495628_0477619 3300046516 Bacteria 902
71 Ga0495637_0065169 3300046520 Bacteria 1484
72 Ga0495643_0221973 3300046522 Bacteria 896
73 Ga0495666_0485921 3300046526 Bacteria 552
74 Ga0495640_0030092 3300046533 Bacteria 3891
75 Ga0495640_0534168 3300046533 Bacteria 712
76 Ga0495587_0105432 3300046536 Bacteria 1621
77 Ga0495622_0216884 3300046557 Bacteria 849
78 Ga0495622_0284320 3300046557 Bacteria 723
79 Ga0495622_0291340 3300046557 Bacteria 712
80 Ga0495634_0518869 3300046642 Bacteria 697
81 Ga0495611_0000874 3300046648 Bacteria 16394
82 Ga0495625_0019854 3300046660 Bacteria 5200
83 Ga0495625_0067366 3300046660 Bacteria 2519
84 Ga0495625_0184495 3300046660 Bacteria 1385
85 Ga0495625_0233919 3300046660 Bacteria 1199
86 Ga0495625_0283048 3300046660 Bacteria 1066
87 Ga0495625_0507210 3300046660 Bacteria 737
88 Ga0495588_0002669 3300046674 Bacteria 7635
89 Ga0495588_0037005 3300046674 Bacteria 2478
90 Ga0495657_0048445 3300046675 Bacteria 2867
91 Ga0495657_0107517 3300046675 Bacteria 1770
92 Ga0495657_0168488 3300046675 Bacteria 1350
93 Ga0495657_0176015 3300046675 Bacteria 1315
94 Ga0495657_0203199 3300046675 Bacteria 1207
95 Ga0495646_0142782 3300046680 Bacteria 1337
96 Ga0495613_0030079 3300046689 Bacteria 4034
97 Ga0495613_0261441 3300046689 Bacteria 1206
98 Ga0495613_0439409 3300046689 Bacteria 885
99 Ga0495613_0495573 3300046689 Bacteria 823
100 Ga0495613_0983982 3300046689 Bacteria 542
101 Ga0495649_0517193 3300046694 Bacteria 593
102 Ga0495600_0025415 3300046809 Bacteria 3817
103 Ga0495600_0054125 3300046809 Bacteria 2621
104 Ga0495600_0082851 3300046809 Bacteria 2093
105 Ga0495660_0036576 3300046810 Bacteria 2738
106 Ga0495660_0075396 3300046810 Bacteria 1780
107 Ga0495660_0335004 3300046810 Bacteria 676
108 Ga0495604_0699834 3300047317 Bacteria 643
109 Ga0495680_0220118 3300047322 Bacteria 1355
110 Ga0495683_0002554 3300047323 Bacteria 10938
111 Ga0495683_0006200 3300047323 Bacteria 6546
112 Ga0495683_0226473 3300047323 Bacteria 831
113 Ga0495687_001447 3300047443 Bacteria 21784
114 Ga0495687_002767 3300047443 Bacteria 13582
115 Ga0495687_006089 3300047443 Bacteria 7494
116 Ga0495687_027301 3300047443 Bacteria 2674
117 Ga0495687_037097 3300047443 Bacteria 2174
118 Ga0495687_050611 3300047443 Bacteria 1769
119 Ga0495687_057199 3300047443 Bacteria 1623
120 Ga0495687_058286 3300047443 Bacteria 1602
121 Ga0495687_105139 3300047443 Bacteria 1050
122 Ga0495687_208723 3300047443 Bacteria 614
123 Ga0495685_187619 3300047447 Bacteria 665
124 Ga0495681_0095425 3300047470 Bacteria 1307
125 Ga0495593_0076012 3300047673 Bacteria 1741
126 Ga0495593_0295806 3300047673 Bacteria 809
127 Ga0495602_0960198 3300048088 Bacteria 566
128 Ga0495614_0000239 3300048089 Bacteria 21327
129 Ga0495614_0002326 3300048089 Bacteria 8453
130 Ga0495614_0057929 3300048089 Bacteria 1663
131 Ga0495614_0096925 3300048089 Bacteria 1286
132 Ga0495614_0182299 3300048089 Bacteria 945
133 Ga0501038_0006311 3300049574 Bacteria 10965
134 Ga0501044_0000680 3300049823 Bacteria 41151
135 Ga0501044_0513955 3300049823 Bacteria 1098
136 nmdc:mga03n38_201138_c1 3300050490 Bacteria 1031
137 nmdc:mga03n38_506289_c1 3300050490 Bacteria 678
138 nmdc:mga07m45_101815_c2 3300050496 Bacteria 912
139 nmdc:mga07m45_144510_c1 3300050496 Bacteria 1378
140 Ga0500660_252002 3300053100 Bacteria 542
141 2616694956 2616644814 Bacteria 11555299
142 2862290826 2862290372 Bacteria 7471434
143 2862577559 2862574272 Bacteria 10567477
144 2947227109 2947224130 Bacteria 9938529
145 2954384790 2954380949 Bacteria 10050426
146 2954695941 2954691527 Bacteria 10720516
147 2954726039 2954721474 Bacteria 10456478
148 2954737524 2954731030 Bacteria 10243860
149 2954744359 2954740390 Bacteria 10229294
150 2954763334 2954759201 Bacteria 9358192
151 3006499339 3006493962 Bacteria 8825450
152 Ga0395898_0605482
153 Ga0081455_10233052
154 Ga0075363_100564010
155 Ga0075367_10797839
156 Ga0075370_10365585
157 Ga0182008_10085712
158 Ga0307517_10011193
159 Ga0307515_10367792
160 Ga0307515_10515954
161 Ga0307511_10053764
162 Ga0307511_10137173
163 Ga0307511_10307508
164 Ga0307512_10072264
165 Ga0307512_10131070
166 Ga0307512_10134557
167 Ga0307512_10165785
168 Ga0307513_10008650
169 Ga0307509_10074242
170 Ga0307509_10099266
171 Ga0307509_10212917
172 Ga0307508_10047762
173 Ga0307508_10074398
174 Ga0307508_10258960
175 Ga0307508_10329031
176 Ga0307508_10345142
177 Ga0307508_10638748
178 Ga0307514_10001637
179 Ga0307514_10036969
180 Ga0307514_10388778
181 Ga0307514_10516722
182 Ga0307518_10084900
183 Ga0307518_10086178
184 Ga0307507_10020856
185 Ga0307507_10026020
186 Ga0307507_10272151
187 Ga0307510_10119323
188 Ga0307510_10271905
189 Ga0451789_1330446
190 Ga0451853_0501441
191 Ga0451853_0684922
192 Ga0451853_1980521
193 Ga0451853_2104036
194 Ga0451853_3270812
195 Ga0466966_0055674
196 Ga0466961_0420359
197 Ga0466963_0315437
198 Ga0466959_0418966
199 Ga0466958_0411435
200 Ga0495617_080639
201 Ga0495603_0040540
202 Ga0495603_0383023
203 Ga0495603_0852560
204 Ga0495629_0001710
205 Ga0495629_0041390
206 Ga0495629_0092202
207 Ga0495629_0299513
208 Ga0495629_0437006
209 Ga0495629_0453129
210 Ga0495651_0601538
211 Ga0495605_0331767
212 Ga0495585_0031421
213 Ga0495585_0300791
214 Ga0495594_0643865
215 Ga0495594_0677062
216 Ga0495583_0003565
217 Ga0495583_0106361
218 Ga0495583_0136522
219 Ga0495618_0114500
220 Ga0495628_0156756
221 Ga0495628_0477619
222 Ga0495637_0065169
223 Ga0495643_0221973
224 Ga0495666_0485921
225 Ga0495640_0030092
226 Ga0495640_0534168
227 Ga0495587_0105432
228 Ga0495622_0216884
229 Ga0495622_0284320
230 Ga0495622_0291340
231 Ga0495634_0518869
232 Ga0495611_0000874
233 Ga0495625_0019854
234 Ga0495625_0067366
235 Ga0495625_0184495
236 Ga0495625_0233919
237 Ga0495625_0283048
238 Ga0495625_0507210
239 Ga0495588_0002669
240 Ga0495588_0037005
241 Ga0495657_0048445
242 Ga0495657_0107517
243 Ga0495657_0168488
244 Ga0495657_0176015
245 Ga0495657_0203199
246 Ga0495646_0142782
247 Ga0495613_0030079
248 Ga0495613_0261441
249 Ga0495613_0439409
250 Ga0495613_0495573
251 Ga0495613_0983982
252 Ga0495649_0517193
253 Ga0495600_0025415
254 Ga0495600_0054125
255 Ga0495600_0082851
256 Ga0495660_0036576
257 Ga0495660_0075396
258 Ga0495660_0335004
259 Ga0495604_0699834
260 Ga0495680_0220118
261 Ga0495683_0002554
262 Ga0495683_0006200
263 Ga0495683_0226473
264 Ga0495687_001447
265 Ga0495687_002767
266 Ga0495687_006089
267 Ga0495687_027301
268 Ga0495687_037097
269 Ga0495687_050611
270 Ga0495687_057199
271 Ga0495687_058286
272 Ga0495687_105139
273 Ga0495687_208723
274 Ga0495685_187619
275 Ga0495681_0095425
276 Ga0495593_0076012
277 Ga0495593_0295806
278 Ga0495602_0960198
279 Ga0495614_0000239
280 Ga0495614_0002326
281 Ga0495614_0057929
282 Ga0495614_0096925
283 Ga0495614_0182299
284 Ga0501038_0006311
285 Ga0501044_0000680
286 Ga0501044_0513955
287 nmdc:mga03n38_201138_c1
288 nmdc:mga03n38_506289_c1
289 nmdc:mga07m45_101815_c2
290 nmdc:mga07m45_144510_c1
291 Ga0500660_252002
292 2616694956
293 2862290826
294 2862577559
295 2947227109
296 2954384790
297 2954695941
298 2954726039
299 2954737524
300 2954744359
301 2954763334
302 3006499339

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yir-assembly1.cif.gz_A crystal structure of rad4-rad23 crosslinked to an undamaged dna 0.7838 30 78
2qsh-assembly1.cif.gz_A crystal structure of rad4-rad23 bound to a mismatch dna 0.6876 30 78
7k04-assembly1.cif.gz_A structure of tfiih/rad4-rad23-rad33/dna in dna opening 0.6799 30 78
6cfi-assembly1.cif.gz_A crystal structure of rad4-rad23 bound to a 6-4 photoproduct uv lesion 0.6789 30 78
7eww-assembly2.cif.gz_B crystal structure of ebinur lake virus cap snatching endonuclease (n52a mutant) 0.568 45 66
ID Description Score Start End Superfamily
af_Q4DV04_296_444_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6632 51 70 2.30.29.30
af_Q46835_23_132_3.30.300.250 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.6592 50 69 3.30.300.250
af_Q8IAU7_59_455_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6267 46 68 2.130.10.10
2xi7C00 Alpha Beta;3-Layer(aba) Sandwich;Restriction Endonuclease; 0.5847 47 64 3.40.91.60
af_Q54L00_1_59_2.10.110.10 Mainly Beta;Ribbon;Cysteine Rich Protein;Cysteine Rich Protein 0.5841 92 120 2.10.110.10
ID Description Score Start End GO Terms
AF-A0A7W2D565-F1-model_v4 Uncharacterized protein 0.9577 5 118
AF-A0A7K2L0C1-F1-model_v4 Uncharacterized protein 0.9551 18 78
AF-A0A7L5XJ08-F1-model_v4 deleted 0.9392 79 119
AF-A0A3N1H9B8-F1-model_v4 Phage derived Gp49-like protein DUF891 0.9358 16 95
AF-A0A7L4Y6A4-F1-model_v4 Uncharacterized protein 0.9334 18 114

Map