F212162

General Info

Members Datasets Scaffolds Average Seq Length
151 110 302 136

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0384657|Ga0373925_0384657_463_942
Length 159
Sequence LCSVRHEYNVQQQAPDQARKKIVMSDSASNQKTSIAPMLSVRRGAKAIEFYKAAFGAGELFRIDDESGSVVARLSVGAAEFWVADESPEHKNFSPETLGGGTVRMVMTVEDPDAAFDRAVAAGATVVWPVSNQHGWRLGRIVDPFGHHWEIGKPLSEGS

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
67 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
68 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
69 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
70 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
71 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
73 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
74 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
75 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
76 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
77 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
78 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
79 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
80 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
81 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
82 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
83 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
84 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
85 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
86 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
87 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
88 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
89 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
90 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
91 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
92 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
93 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
94 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
95 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
96 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
97 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
98 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
99 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
104 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
105 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
106 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
107 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
108 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
109 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
110 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.62
Rhizosphere 93.38
Stem 0
Stem Tuber 0
Unclassified 40.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0384657 3300037068 Bacteria 1143
2 JGI25406J46586_10036656 3300003203 Unclassified 1777
3 Ga0068869_100815588 3300005334 Bacteria 803
4 Ga0070669_100847074 3300005353 Bacteria 779
5 Ga0070671_100026178 3300005355 Bacteria 4793
6 Ga0070671_101361947 3300005355 Unclassified 626
7 Ga0070667_100253030 3300005367 Bacteria 1575
8 Ga0070714_101112642 3300005435 Bacteria 770
9 Ga0070705_101666598 3300005440 Unclassified 538
10 Ga0070708_100011926 3300005445 Bacteria 7081
11 Ga0070707_100286080 3300005468 Bacteria 1602
12 Ga0070698_101392645 3300005471 Bacteria 652
13 Ga0070699_100773622 3300005518 Unclassified 878
14 Ga0070697_100089289 3300005536 Bacteria 2546
15 Ga0070697_101091043 3300005536 Unclassified 710
16 Ga0070665_100069337 3300005548 Unclassified 3534
17 Ga0070665_100244211 3300005548 Bacteria 1796
18 Ga0070665_100964336 3300005548 Bacteria 865
19 Ga0070704_100027741 3300005549 Bacteria 3760
20 Ga0068859_100047676 3300005617 Bacteria 4305
21 Ga0068859_102253965 3300005617 Unclassified 601
22 Ga0068864_100036952 3300005618 Bacteria 4165
23 Ga0068864_100449092 3300005618 Unclassified 1233
24 Ga0068866_11037991 3300005718 Bacteria 584
25 Ga0068861_100720184 3300005719 Unclassified 929
26 Ga0068863_100317832 3300005841 Bacteria 1512
27 Ga0068863_100320297 3300005841 Bacteria 1506
28 Ga0068863_100972686 3300005841 Unclassified 851
29 Ga0068863_101587463 3300005841 Unclassified 663
30 Ga0068860_100003071 3300005843 Bacteria 17254
31 Ga0068860_102401208 3300005843 Unclassified 547
32 Ga0068862_100200852 3300005844 Unclassified 1797
33 Ga0081539_10007086 3300005985 Bacteria 10367
34 Ga0070717_10154059 3300006028 Bacteria 1990
35 Ga0070717_10295453 3300006028 Unclassified 1439
36 Ga0070717_10566573 3300006028 Bacteria 1029
37 Ga0070716_100958986 3300006173 Unclassified 674
38 Ga0070712_100238698 3300006175 Bacteria 1447
39 Ga0097621_101575550 3300006237 Unclassified 624
40 Ga0068871_101051558 3300006358 Bacteria 760
41 Ga0075428_100045559 3300006844 Bacteria 4819
42 Ga0075430_100552665 3300006846 Unclassified 950
43 Ga0075431_100990141 3300006847 Unclassified 808
44 Ga0075433_10344384 3300006852 Bacteria 1317
45 Ga0075434_100157735 3300006871 Unclassified 2288
46 Ga0097620_100047677 3300006931 Bacteria 4305
47 Ga0097620_102254637 3300006931 Unclassified 601
48 Ga0105240_10000264 3300009093 Bacteria 103844
49 Ga0105240_10109777 3300009093 Unclassified 3340
50 Ga0105247_10730441 3300009101 Bacteria 748
51 Ga0114129_10029536 3300009147 Bacteria 7764
52 Ga0105243_12319963 3300009148 Unclassified 574
53 Ga0105242_10431776 3300009176 Unclassified 1237
54 Ga0105242_10669802 3300009176 Bacteria 1011
55 Ga0105242_10670209 3300009176 Bacteria 1011
56 Ga0105248_10092906 3300009177 Bacteria 3398
57 Ga0105248_10151702 3300009177 Unclassified 2615
58 Ga0105248_10247908 3300009177 Bacteria 2005
59 Ga0105248_10489505 3300009177 Bacteria 1386
60 Ga0105248_10561657 3300009177 Bacteria 1288
61 Ga0105237_10462265 3300009545 Bacteria 1275
62 Ga0105239_10295010 3300010375 Bacteria 1826
63 Ga0157378_10001669 3300013297 Bacteria 20038
64 Ga0163162_10008421 3300013306 Bacteria 10056
65 Ga0163162_10029780 3300013306 Bacteria 5404
66 Ga0163162_12377765 3300013306 Unclassified 609
67 Ga0157372_11661268 3300013307 Bacteria 735
68 Ga0157375_10016090 3300013308 Bacteria 6710
69 Ga0163163_10017904 3300014325 Bacteria 6616
70 Ga0163163_11045039 3300014325 Bacteria 880
71 Ga0163163_12811463 3300014325 Bacteria 543
72 Ga0157379_10179140 3300014968 Bacteria 1915
73 Ga0207699_10388325 3300025906 Unclassified 992
74 Ga0207684_10073030 3300025910 Bacteria 2913
75 Ga0207695_10016143 3300025913 Bacteria 8759
76 Ga0207663_10638233 3300025916 Unclassified 840
77 Ga0207681_11450428 3300025923 Unclassified 576
78 Ga0207644_10016295 3300025931 Bacteria 5000
79 Ga0207686_10567213 3300025934 Bacteria 889
80 Ga0207709_10590485 3300025935 Unclassified 878
81 Ga0207665_10155133 3300025939 Bacteria 1643
82 Ga0207665_11287838 3300025939 Unclassified 583
83 Ga0207711_10041205 3300025941 Unclassified 3932
84 Ga0207711_10334449 3300025941 Bacteria 1401
85 Ga0207658_10349614 3300025986 Bacteria 1287
86 Ga0207641_10346825 3300026088 Bacteria 1414
87 Ga0207641_10435317 3300026088 Bacteria 1265
88 Ga0207676_10019146 3300026095 Bacteria 4989
89 Ga0265355_1007341 3300028036 Unclassified 871
90 Ga0268266_10036539 3300028379 Bacteria 4182
91 Ga0268266_11361978 3300028379 Unclassified 685
92 Ga0268265_10280036 3300028380 Bacteria 1492
93 Ga0268264_10060887 3300028381 Bacteria 3165
94 Ga0316577_10045239 3300031733 Bacteria 2460
95 Ga0373953_0062311 3300035117 Bacteria 1527
96 Ga0373955_0032270 3300035172 Bacteria 2748
97 Ga0373927_0855455 3300035695 Unclassified 600
98 Ga0373933_0050934 3300035724 Unclassified 2473
99 Ga0373937_0012827 3300036401 Bacteria 7381
100 Ga0373937_0135900 3300036401 Unclassified 2299
101 Ga0373937_0673324 3300036401 Unclassified 981
102 Ga0373937_1031862 3300036401 Unclassified 771
103 Ga0316581_0039913 3300037588 Bacteria 1429
104 Ga0451577_0689435 3300042876 Unclassified 926
105 Ga0466972_0347533 3300044658 Unclassified 694
106 Ga0453684_0070463 3300044712 Bacteria 4428
107 Ga0451576_2075115 3300045051 Unclassified 585
108 Ga0495592_0410264 3300046454 Bacteria 856
109 Ga0495603_0279368 3300046455 Unclassified 960
110 Ga0495651_0160213 3300046462 Bacteria 1613
111 Ga0495651_0255491 3300046462 Bacteria 1195
112 Ga0495651_0312307 3300046462 Unclassified 1051
113 Ga0495653_0711752 3300046463 Bacteria 609
114 Ga0495580_0078801 3300046472 Unclassified 2298
115 Ga0495664_0050422 3300046477 Bacteria 2472
116 Ga0495594_0354474 3300046499 Unclassified 835
117 Ga0495652_0051870 3300046529 Unclassified 3501
118 Ga0495640_0186643 3300046533 Unclassified 1319
119 Ga0495645_0036817 3300046543 Bacteria 3567
120 Ga0495645_0590642 3300046543 Unclassified 684
121 Ga0495667_0179597 3300046559 Unclassified 1359
122 Ga0495667_0240116 3300046559 Unclassified 1154
123 Ga0495634_0075092 3300046642 Bacteria 2221
124 Ga0495659_0056036 3300046664 Bacteria 1446
125 Ga0495604_0211442 3300047317 Bacteria 1340
126 Ga0495674_0087042 3300047319 Unclassified 2674
127 Ga0495674_0097935 3300047319 Unclassified 2498
128 Ga0495674_0231736 3300047319 Unclassified 1524
129 Ga0495672_0001851 3300047320 Bacteria 20173
130 Ga0495675_0099606 3300047444 Unclassified 1820
131 Ga0495684_0149394 3300047471 Unclassified 1748
132 Ga0495602_0613152 3300048088 Bacteria 747
133 Ga0496100_0149681 3300048903 Bacteria 1663
134 Ga0496100_0888426 3300048903 Unclassified 700
135 Ga0496102_0006095 3300048905 Bacteria 10280
136 Ga0496105_0197657 3300048908 Bacteria 1642
137 Ga0496105_1152633 3300048908 Bacteria 573
138 Ga0496106_0038717 3300048909 Bacteria 3570
139 Ga0496109_0275364 3300048912 Bacteria 1586
140 Ga0496112_0223656 3300048915 Bacteria 1838
141 Ga0496112_0367542 3300048915 Bacteria 1380
142 Ga0496115_1378088 3300048918 Unclassified 522
143 Ga0501080_0003971 3300049742 Bacteria 13101
144 nmdc:mga05p37_112279_c1 3300050507 Bacteria 3351
145 nmdc:mga0qj67_1097751_c1 3300050509 Unclassified 622
146 nmdc:mga06r32_181551_c1 3300050510 Bacteria 2090
147 nmdc:mga0n895_101473_c1 3300050512 Unclassified 2887
148 nmdc:mga08x19_1060890_c1 3300050514 Unclassified 575
149 nmdc:mga08x19_638998_c1 3300050514 Bacteria 755
150 nmdc:mga0a205_408136_c1 3300050515 Unclassified 1222
151 Ga0495595_0211869 3300053084 Bacteria 966
152 Ga0373925_0384657
153 JGI25406J46586_10036656
154 Ga0068869_100815588
155 Ga0070669_100847074
156 Ga0070671_100026178
157 Ga0070671_101361947
158 Ga0070667_100253030
159 Ga0070714_101112642
160 Ga0070705_101666598
161 Ga0070708_100011926
162 Ga0070707_100286080
163 Ga0070698_101392645
164 Ga0070699_100773622
165 Ga0070697_100089289
166 Ga0070697_101091043
167 Ga0070665_100069337
168 Ga0070665_100244211
169 Ga0070665_100964336
170 Ga0070704_100027741
171 Ga0068859_100047676
172 Ga0068859_102253965
173 Ga0068864_100036952
174 Ga0068864_100449092
175 Ga0068866_11037991
176 Ga0068861_100720184
177 Ga0068863_100317832
178 Ga0068863_100320297
179 Ga0068863_100972686
180 Ga0068863_101587463
181 Ga0068860_100003071
182 Ga0068860_102401208
183 Ga0068862_100200852
184 Ga0081539_10007086
185 Ga0070717_10154059
186 Ga0070717_10295453
187 Ga0070717_10566573
188 Ga0070716_100958986
189 Ga0070712_100238698
190 Ga0097621_101575550
191 Ga0068871_101051558
192 Ga0075428_100045559
193 Ga0075430_100552665
194 Ga0075431_100990141
195 Ga0075433_10344384
196 Ga0075434_100157735
197 Ga0097620_100047677
198 Ga0097620_102254637
199 Ga0105240_10000264
200 Ga0105240_10109777
201 Ga0105247_10730441
202 Ga0114129_10029536
203 Ga0105243_12319963
204 Ga0105242_10431776
205 Ga0105242_10669802
206 Ga0105242_10670209
207 Ga0105248_10092906
208 Ga0105248_10151702
209 Ga0105248_10247908
210 Ga0105248_10489505
211 Ga0105248_10561657
212 Ga0105237_10462265
213 Ga0105239_10295010
214 Ga0157378_10001669
215 Ga0163162_10008421
216 Ga0163162_10029780
217 Ga0163162_12377765
218 Ga0157372_11661268
219 Ga0157375_10016090
220 Ga0163163_10017904
221 Ga0163163_11045039
222 Ga0163163_12811463
223 Ga0157379_10179140
224 Ga0207699_10388325
225 Ga0207684_10073030
226 Ga0207695_10016143
227 Ga0207663_10638233
228 Ga0207681_11450428
229 Ga0207644_10016295
230 Ga0207686_10567213
231 Ga0207709_10590485
232 Ga0207665_10155133
233 Ga0207665_11287838
234 Ga0207711_10041205
235 Ga0207711_10334449
236 Ga0207658_10349614
237 Ga0207641_10346825
238 Ga0207641_10435317
239 Ga0207676_10019146
240 Ga0265355_1007341
241 Ga0268266_10036539
242 Ga0268266_11361978
243 Ga0268265_10280036
244 Ga0268264_10060887
245 Ga0316577_10045239
246 Ga0373953_0062311
247 Ga0373955_0032270
248 Ga0373927_0855455
249 Ga0373933_0050934
250 Ga0373937_0012827
251 Ga0373937_0135900
252 Ga0373937_0673324
253 Ga0373937_1031862
254 Ga0316581_0039913
255 Ga0451577_0689435
256 Ga0466972_0347533
257 Ga0453684_0070463
258 Ga0451576_2075115
259 Ga0495592_0410264
260 Ga0495603_0279368
261 Ga0495651_0160213
262 Ga0495651_0255491
263 Ga0495651_0312307
264 Ga0495653_0711752
265 Ga0495580_0078801
266 Ga0495664_0050422
267 Ga0495594_0354474
268 Ga0495652_0051870
269 Ga0495640_0186643
270 Ga0495645_0036817
271 Ga0495645_0590642
272 Ga0495667_0179597
273 Ga0495667_0240116
274 Ga0495634_0075092
275 Ga0495659_0056036
276 Ga0495604_0211442
277 Ga0495674_0087042
278 Ga0495674_0097935
279 Ga0495674_0231736
280 Ga0495672_0001851
281 Ga0495675_0099606
282 Ga0495684_0149394
283 Ga0495602_0613152
284 Ga0496100_0149681
285 Ga0496100_0888426
286 Ga0496102_0006095
287 Ga0496105_0197657
288 Ga0496105_1152633
289 Ga0496106_0038717
290 Ga0496109_0275364
291 Ga0496112_0223656
292 Ga0496112_0367542
293 Ga0496115_1378088
294 Ga0501080_0003971
295 nmdc:mga05p37_112279_c1
296 nmdc:mga0qj67_1097751_c1
297 nmdc:mga06r32_181551_c1
298 nmdc:mga0n895_101473_c1
299 nmdc:mga08x19_1060890_c1
300 nmdc:mga08x19_638998_c1
301 nmdc:mga0a205_408136_c1
302 Ga0495595_0211869

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

34

151

0.77

PF18029

Glyoxalase_6

Glyoxalase-like domain

38

152

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.8222 11 133
3vcx-assembly1.cif.gz_B crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.8136 12 135
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.8105 11 135
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.808 12 137
3vcx-assembly1.cif.gz_B crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.8075 12 135
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9598 83 135 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8819 84 133 3.30.720.110
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.881 83 135 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8704 83 131 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8603 84 135 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A1M3GA39-F1-model_v4 Glyoxalase 0.9893 12 136
AF-A0A2V7Q3L8-F1-model_v4 Glyoxalase 0.9869 18 135
AF-A0A1Q7MZY8-F1-model_v4 Glyoxalase 0.9845 12 135
AF-A0A4R2CUQ4-F1-model_v4 PhnB protein 0.9781 13 135
AF-A0A7X4H0T2-F1-model_v4 VOC family protein 0.9768 12 135

Map