F210772

General Info

Members Datasets Scaffolds Average Seq Length
151 110 302 147

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100120328|Ga0070674_1001203282
Length 167
Sequence MAAMPVRRPDTPLIPLSFTEATHHHLESLADDVHRTYFSKYPPLPVRWGQQISRKKRRSIRLGSYNHHTAEVRIHPMLNSRSVPRIFVESVIYHEYLHHVLGPHHNRRFHQAERKFRYHREAQEWIRRNLFFLLGRKRGMRRPVVLESPRAVQVSLFALEQPLDRQA

Samples

Sample ID Description Type Environment
1 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
92 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
97 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
98 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
101 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
102 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
103 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
104 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
105 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
106 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
107 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
108 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
109 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
110 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.66
Rhizosphere 91.39
Stem 0
Stem Tuber 0
Unclassified 13.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070674_100120328 3300005356 Bacteria 1943
2 Ga0070658_10021909 3300005327 Bacteria 5125
3 Ga0070676_10368891 3300005328 Bacteria 991
4 Ga0070683_100000022 3300005329 Bacteria 180088
5 Ga0070683_100170007 3300005329 Bacteria 2069
6 Ga0070670_100000351 3300005331 Bacteria 38642
7 Ga0070682_100532466 3300005337 Archaea 916
8 Ga0068868_100000069 3300005338 Bacteria 59364
9 Ga0068868_100004245 3300005338 Bacteria 10023
10 Ga0070689_100000504 3300005340 Bacteria 23059
11 Ga0070661_101345581 3300005344 Unclassified 600
12 Ga0070692_10000964 3300005345 Bacteria 9817
13 Ga0070675_100000030 3300005354 Bacteria 100523
14 Ga0070674_100048962 3300005356 Bacteria 2903
15 Ga0070673_100099524 3300005364 Bacteria 2392
16 Ga0070700_100000009 3300005441 Bacteria 181474
17 Ga0070708_100012931 3300005445 Bacteria 6819
18 Ga0068867_101351244 3300005459 Bacteria 659
19 Ga0070685_10009870 3300005466 Bacteria 4950
20 Ga0070706_100143547 3300005467 Bacteria 2229
21 Ga0070707_100024755 3300005468 Bacteria 5689
22 Ga0070707_100784420 3300005468 Bacteria 916
23 Ga0070699_100084977 3300005518 Bacteria 2762
24 Ga0070699_100575972 3300005518 Bacteria 1026
25 Ga0070684_100003484 3300005535 Bacteria 11815
26 Ga0070697_100571272 3300005536 Bacteria 992
27 Ga0068853_100026162 3300005539 Bacteria 4899
28 Ga0070686_100197212 3300005544 Unclassified 1441
29 Ga0070693_100183400 3300005547 Bacteria 1349
30 Ga0068854_100127215 3300005578 Bacteria 1942
31 Ga0070702_100000740 3300005615 Bacteria 12359
32 Ga0068864_100000025 3300005618 Bacteria 250062
33 Ga0068861_100123258 3300005719 Bacteria 2094
34 Ga0068861_101861360 3300005719 Unclassified 598
35 Ga0068851_10257750 3300005834 Unclassified 991
36 Ga0068870_10006303 3300005840 Bacteria 5223
37 Ga0068870_10025290 3300005840 Bacteria 2946
38 Ga0068858_100000524 3300005842 Bacteria 40268
39 Ga0068858_100278737 3300005842 Unclassified 1592
40 Ga0068860_100874803 3300005843 Bacteria 914
41 Ga0070717_10283913 3300006028 Bacteria 1469
42 Ga0070716_101013747 3300006173 Unclassified 657
43 Ga0097621_100202781 3300006237 Bacteria 1723
44 Ga0068871_100150601 3300006358 Bacteria 1984
45 Ga0068871_100593477 3300006358 Unclassified 1007
46 Ga0075428_100001387 3300006844 Bacteria 25803
47 Ga0075431_100002181 3300006847 Bacteria 18713
48 Ga0075434_100461032 3300006871 Unclassified 1292
49 Ga0075434_100756339 3300006871 Bacteria 989
50 Ga0075436_100741162 3300006914 Bacteria 729
51 Ga0075435_100023566 3300007076 Bacteria 4763
52 Ga0105244_10066451 3300009036 Bacteria 1805
53 Ga0111539_10000007 3300009094 Bacteria 418059
54 Ga0105245_10000010 3300009098 Bacteria 278233
55 Ga0105245_10001122 3300009098 Bacteria 24219
56 Ga0105245_11205095 3300009098 Bacteria 805
57 Ga0105242_10007569 3300009176 Bacteria 8360
58 Ga0105248_10835991 3300009177 Bacteria 1039
59 Ga0105238_10000008 3300009551 Bacteria 307196
60 Ga0105239_10127117 3300010375 Bacteria 2834
61 Ga0157369_10011713 3300013105 Bacteria 9957
62 Ga0157374_10000008 3300013296 Bacteria 588863
63 Ga0157378_10000809 3300013297 Bacteria 29082
64 Ga0157378_10016053 3300013297 Bacteria 6559
65 Ga0157378_10367265 3300013297 Bacteria 1410
66 Ga0157372_11037331 3300013307 Bacteria 949
67 Ga0157375_10000034 3300013308 Bacteria 184385
68 Ga0157375_10000474 3300013308 Bacteria 36636
69 Ga0157375_10001324 3300013308 Bacteria 21378
70 Ga0163163_10426856 3300014325 Bacteria 1385
71 Ga0157380_10012561 3300014326 Bacteria 6146
72 Ga0157377_10000042 3300014745 Bacteria 106623
73 Ga0157377_10001863 3300014745 Bacteria 9228
74 Ga0157379_10717321 3300014968 Unclassified 939
75 Ga0157376_10000002 3300014969 Bacteria 684532
76 Ga0213873_10000001 3300021358 Bacteria 1657979
77 Ga0213873_10042611 3300021358 Unclassified 1174
78 Ga0213876_10000015 3300021384 Bacteria 304025
79 Ga0213876_10000019 3300021384 Bacteria 279426
80 Ga0213876_10069343 3300021384 Bacteria 1862
81 Ga0213875_10071215 3300021388 Bacteria 1623
82 Ga0207656_10187174 3300025321 Unclassified 996
83 Ga0207692_10301177 3300025898 Bacteria 976
84 Ga0207643_10046278 3300025908 Bacteria 2459
85 Ga0207643_10080401 3300025908 Bacteria 1888
86 Ga0207705_10130087 3300025909 Unclassified 1873
87 Ga0207684_10139232 3300025910 Bacteria 2085
88 Ga0207684_10151212 3300025910 Bacteria 1997
89 Ga0207684_10570316 3300025910 Bacteria 968
90 Ga0207695_10030404 3300025913 Bacteria 5944
91 Ga0207695_11535216 3300025913 Unclassified 546
92 Ga0207662_10001534 3300025918 Bacteria 11260
93 Ga0207646_10006368 3300025922 Bacteria 12211
94 Ga0207646_10613377 3300025922 Bacteria 976
95 Ga0207694_10000001 3300025924 Bacteria 4078485
96 Ga0207650_10000071 3300025925 Bacteria 137924
97 Ga0207650_10433200 3300025925 Bacteria 1092
98 Ga0207659_10000002 3300025926 Bacteria 619441
99 Ga0207687_10000005 3300025927 Bacteria 770649
100 Ga0207687_10000413 3300025927 Bacteria 28968
101 Ga0207687_10332274 3300025927 Unclassified 1233
102 Ga0207664_10731544 3300025929 Bacteria 890
103 Ga0207686_10004437 3300025934 Bacteria 7523
104 Ga0207670_10000113 3300025936 Bacteria 54526
105 Ga0207665_10340943 3300025939 Bacteria 1129
106 Ga0207691_10003585 3300025940 Bacteria 15093
107 Ga0207689_10008374 3300025942 Bacteria 9005
108 Ga0207689_10549045 3300025942 Bacteria 970
109 Ga0207661_10000009 3300025944 Bacteria 421876
110 Ga0207661_10507379 3300025944 Unclassified 1102
111 Ga0207651_10459966 3300025960 Bacteria 1093
112 Ga0207651_11738354 3300025960 Bacteria 562
113 Ga0207640_10014428 3300025981 Bacteria 4551
114 Ga0207677_10000020 3300026023 Bacteria 137014
115 Ga0207677_10000067 3300026023 Bacteria 87739
116 Ga0207703_10000192 3300026035 Bacteria 71634
117 Ga0207639_10000028 3300026041 Bacteria 197736
118 Ga0207708_10000003 3300026075 Bacteria 324662
119 Ga0207676_10000002 3300026095 Bacteria 1198607
120 Ga0207674_11106397 3300026116 Unclassified 762
121 Ga0207675_100105020 3300026118 Bacteria 2662
122 Ga0207675_100766343 3300026118 Bacteria 977
123 Ga0207675_101027066 3300026118 Bacteria 843
124 Ga0207428_10000008 3300027907 Bacteria 423201
125 Ga0307511_10001241 3300030521 Bacteria 26961
126 Ga0373943_0004017 3300035170 Bacteria 6692
127 Ga0373947_0778983 3300035725 Unclassified 653
128 Ga0436364_0582916 3300037853 Unclassified 1684
129 Ga0436365_0071333 3300039437 Bacteria 94023
130 Ga0436365_0161434 3300039437 Bacteria 117675
131 Ga0436365_0344296 3300039437 Bacteria 7841
132 Ga0436365_0406713 3300039437 Bacteria 555
133 Ga0436365_1237367 3300039437 Bacteria 1850
134 Ga0436365_1841634 3300039437 Bacteria 1712
135 Ga0436362_1287199 3300039453 Bacteria 7411
136 Ga0436362_1305298 3300039453 Bacteria 131464
137 Ga0451800_1324762 3300041459 Bacteria 642
138 Ga0451577_0163742 3300042876 Bacteria 2004
139 Ga0451576_0401233 3300045051 Bacteria 1438
140 Ga0495620_0002679 3300046515 Bacteria 10283
141 Ga0495621_0091237 3300046539 Unclassified 1148
142 Ga0495588_0750805 3300046674 Unclassified 510
143 Ga0495679_123529 3300047446 Bacteria 706
144 Ga0501073_0010139 3300049589 Bacteria 6923
145 Ga0501080_0001417 3300049742 Bacteria 20111
146 nmdc:mga09592_93343_c1 3300050508 Bacteria 2573
147 nmdc:mga06r32_1563_c1 3300050510 Bacteria 20666
148 nmdc:mga08y16_13_c2 3300050511 Bacteria 418063
149 nmdc:mga0n895_494195_c1 3300050512 Unclassified 1233
150 nmdc:mga0n895_759274_c1 3300050512 Bacteria 962
151 nmdc:mga0rr50_17278_c1 3300050513 Bacteria 4813
152 Ga0070674_100120328
153 Ga0070658_10021909
154 Ga0070676_10368891
155 Ga0070683_100000022
156 Ga0070683_100170007
157 Ga0070670_100000351
158 Ga0070682_100532466
159 Ga0068868_100000069
160 Ga0068868_100004245
161 Ga0070689_100000504
162 Ga0070661_101345581
163 Ga0070692_10000964
164 Ga0070675_100000030
165 Ga0070674_100048962
166 Ga0070673_100099524
167 Ga0070700_100000009
168 Ga0070708_100012931
169 Ga0068867_101351244
170 Ga0070685_10009870
171 Ga0070706_100143547
172 Ga0070707_100024755
173 Ga0070707_100784420
174 Ga0070699_100084977
175 Ga0070699_100575972
176 Ga0070684_100003484
177 Ga0070697_100571272
178 Ga0068853_100026162
179 Ga0070686_100197212
180 Ga0070693_100183400
181 Ga0068854_100127215
182 Ga0070702_100000740
183 Ga0068864_100000025
184 Ga0068861_100123258
185 Ga0068861_101861360
186 Ga0068851_10257750
187 Ga0068870_10006303
188 Ga0068870_10025290
189 Ga0068858_100000524
190 Ga0068858_100278737
191 Ga0068860_100874803
192 Ga0070717_10283913
193 Ga0070716_101013747
194 Ga0097621_100202781
195 Ga0068871_100150601
196 Ga0068871_100593477
197 Ga0075428_100001387
198 Ga0075431_100002181
199 Ga0075434_100461032
200 Ga0075434_100756339
201 Ga0075436_100741162
202 Ga0075435_100023566
203 Ga0105244_10066451
204 Ga0111539_10000007
205 Ga0105245_10000010
206 Ga0105245_10001122
207 Ga0105245_11205095
208 Ga0105242_10007569
209 Ga0105248_10835991
210 Ga0105238_10000008
211 Ga0105239_10127117
212 Ga0157369_10011713
213 Ga0157374_10000008
214 Ga0157378_10000809
215 Ga0157378_10016053
216 Ga0157378_10367265
217 Ga0157372_11037331
218 Ga0157375_10000034
219 Ga0157375_10000474
220 Ga0157375_10001324
221 Ga0163163_10426856
222 Ga0157380_10012561
223 Ga0157377_10000042
224 Ga0157377_10001863
225 Ga0157379_10717321
226 Ga0157376_10000002
227 Ga0213873_10000001
228 Ga0213873_10042611
229 Ga0213876_10000015
230 Ga0213876_10000019
231 Ga0213876_10069343
232 Ga0213875_10071215
233 Ga0207656_10187174
234 Ga0207692_10301177
235 Ga0207643_10046278
236 Ga0207643_10080401
237 Ga0207705_10130087
238 Ga0207684_10139232
239 Ga0207684_10151212
240 Ga0207684_10570316
241 Ga0207695_10030404
242 Ga0207695_11535216
243 Ga0207662_10001534
244 Ga0207646_10006368
245 Ga0207646_10613377
246 Ga0207694_10000001
247 Ga0207650_10000071
248 Ga0207650_10433200
249 Ga0207659_10000002
250 Ga0207687_10000005
251 Ga0207687_10000413
252 Ga0207687_10332274
253 Ga0207664_10731544
254 Ga0207686_10004437
255 Ga0207670_10000113
256 Ga0207665_10340943
257 Ga0207691_10003585
258 Ga0207689_10008374
259 Ga0207689_10549045
260 Ga0207661_10000009
261 Ga0207661_10507379
262 Ga0207651_10459966
263 Ga0207651_11738354
264 Ga0207640_10014428
265 Ga0207677_10000020
266 Ga0207677_10000067
267 Ga0207703_10000192
268 Ga0207639_10000028
269 Ga0207708_10000003
270 Ga0207676_10000002
271 Ga0207674_11106397
272 Ga0207675_100105020
273 Ga0207675_100766343
274 Ga0207675_101027066
275 Ga0207428_10000008
276 Ga0307511_10001241
277 Ga0373943_0004017
278 Ga0373947_0778983
279 Ga0436364_0582916
280 Ga0436365_0071333
281 Ga0436365_0161434
282 Ga0436365_0344296
283 Ga0436365_0406713
284 Ga0436365_1237367
285 Ga0436365_1841634
286 Ga0436362_1287199
287 Ga0436362_1305298
288 Ga0451800_1324762
289 Ga0451577_0163742
290 Ga0451576_0401233
291 Ga0495620_0002679
292 Ga0495621_0091237
293 Ga0495588_0750805
294 Ga0495679_123529
295 Ga0501073_0010139
296 Ga0501080_0001417
297 nmdc:mga09592_93343_c1
298 nmdc:mga06r32_1563_c1
299 nmdc:mga08y16_13_c2
300 nmdc:mga0n895_494195_c1
301 nmdc:mga0n895_759274_c1
302 nmdc:mga0rr50_17278_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jix-assembly1.cif.gz_A crystal structure of the metallopeptidase zymogen of methanocaldococcus jannaschii jannalysin 0.7854 17 125
4jiu-assembly1.cif.gz_A crystal structure of the metallopeptidase zymogen of pyrococcus abyssi abylysin 0.7695 18 127
4qhi-assembly2.cif.gz_C crystal structure of methanocaldococcus jannaschii selecase mutant r36w 0.7655 16 129
4qhi-assembly2.cif.gz_C crystal structure of methanocaldococcus jannaschii selecase mutant r36w 0.753 16 129
4jix-assembly1.cif.gz_B crystal structure of the metallopeptidase zymogen of methanocaldococcus jannaschii jannalysin 0.7482 18 126
ID Description Score Start End Superfamily
4jiuA00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7697 18 127 3.30.2010.10
4qhiC00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7655 16 129 3.30.2010.10
4qhiC00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.753 16 129 3.30.2010.10
4jixB00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7482 18 126 3.30.2010.10
4jiuA00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7328 18 127 3.30.2010.10
ID Description Score Start End GO Terms
AF-A0A7Y4ZS12-F1-model_v4 M48 family peptidase 0.9648 19 127
AF-A0A3A8N997-F1-model_v4 M48 family peptidase 0.9554 19 126
AF-A0A2V8TCG7-F1-model_v4 SprT-like domain-containing protein 0.955 19 127 GO:0033554
AF-A0A085VYT0-F1-model_v4 SprT-like domain-containing protein 0.9533 19 126
AF-A0A534PZQ5-F1-model_v4 M48 family metallopeptidase 0.9525 19 126

Map