F210771

General Info

Members Datasets Scaffolds Average Seq Length
151 98 302 335

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100041307|Ga0070674_1000413073
Length 368
Sequence VHAPTDVSLPRRHFLATPLIAMAHRIGGSAHESIPGGATQAATSKRFRHPGFLDLQVNGFAGVDYNEPETTADRILDSVSALRRSGVTRFLATLISQPLDRFSQCAKTVLAARSNAILGIHMEGPYISPEDGARGAHRREDTSPASIDDFRRRQDAANGTIRLVTVAPEVPGVLELIGYLRTNGVHVAIGHTAATPKQIQDGIAAGATLSTHLGNGCAQMLPRHPNVIWEQLAADALTASMIIDGHHLPPSTVKAMVRAKTPSRVVLVTDATAAAGQPPGDYKLGALMVHVDDTGRVAVPGQPYLAGSALSMDRAVGNMVRFAGVSLEEALDMASKRPAAYLNIEPAGTLDLEWDADASVLHVRSVSD

Samples

Sample ID Description Type Environment
1 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
76 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
77 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
78 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
79 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
80 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
81 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
82 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
83 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
84 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
85 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
86 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
88 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
89 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
90 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
91 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
92 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
93 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
94 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
95 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
96 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
97 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
98 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 6.62
Rhizosphere 92.05
Stem 0
Stem Tuber 0
Unclassified 14.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070674_100041307 3300005356 Unclassified 3124
2 Ga0065715_10000750 3300005293 Bacteria 14344
3 Ga0065715_10119130 3300005293 Unclassified 2295
4 Ga0070670_100091088 3300005331 Bacteria 2621
5 Ga0070670_100173711 3300005331 Bacteria 1869
6 Ga0068869_100062831 3300005334 Bacteria 2726
7 Ga0070680_100169070 3300005336 Unclassified 1839
8 Ga0068868_100117699 3300005338 Bacteria 2165
9 Ga0068868_100241701 3300005338 Unclassified 1517
10 Ga0070668_100310061 3300005347 Unclassified 1326
11 Ga0070669_100014837 3300005353 Bacteria 5549
12 Ga0070675_100058730 3300005354 Bacteria 3173
13 Ga0070674_100049026 3300005356 Bacteria 2901
14 Ga0070688_100023115 3300005365 Bacteria 3653
15 Ga0070688_100091167 3300005365 Bacteria 1992
16 Ga0070709_10242245 3300005434 Bacteria 1295
17 Ga0068867_100133826 3300005459 Unclassified 1930
18 Ga0070707_100130928 3300005468 Bacteria 2439
19 Ga0070698_100204243 3300005471 Bacteria 1911
20 Ga0070698_100204288 3300005471 Bacteria 1911
21 Ga0070698_100569712 3300005471 Unclassified 1072
22 Ga0070699_100027290 3300005518 Bacteria 4927
23 Ga0070699_100289964 3300005518 Bacteria 1467
24 Ga0070697_100087595 3300005536 Bacteria 2571
25 Ga0070672_100025193 3300005543 Bacteria 4409
26 Ga0070686_100151984 3300005544 Bacteria 1622
27 Ga0070695_100069187 3300005545 Bacteria 2307
28 Ga0070695_100423478 3300005545 Unclassified 1014
29 Ga0070696_100069361 3300005546 Bacteria 2477
30 Ga0070665_100016645 3300005548 Bacteria 7369
31 Ga0070704_100033793 3300005549 Bacteria 3461
32 Ga0068859_100133632 3300005617 Bacteria 2553
33 Ga0068864_100015817 3300005618 Bacteria 6277
34 Ga0068864_100174217 3300005618 Bacteria 1963
35 Ga0068864_100413039 3300005618 Bacteria 1284
36 Ga0068861_100045970 3300005719 Bacteria 3290
37 Ga0068858_100085155 3300005842 Bacteria 2940
38 Ga0068862_100057410 3300005844 Bacteria 3338
39 Ga0075365_10007232 3300006038 Bacteria 6202
40 Ga0097621_100111098 3300006237 Bacteria 2316
41 Ga0075428_100003866 3300006844 Bacteria 16450
42 Ga0075431_100191948 3300006847 Bacteria 2093
43 Ga0075433_10068142 3300006852 Bacteria 3124
44 Ga0075433_10143428 3300006852 Unclassified 2123
45 Ga0075434_100000022 3300006871 Bacteria 68968
46 Ga0075434_100032541 3300006871 Bacteria 5142
47 Ga0075434_100063025 3300006871 Bacteria 3690
48 Ga0075434_100071597 3300006871 Bacteria 3458
49 Ga0075429_100083762 3300006880 Bacteria 2780
50 Ga0075436_100001549 3300006914 Bacteria 15697
51 Ga0075436_100015087 3300006914 Bacteria 5295
52 Ga0075436_100026319 3300006914 Bacteria 4005
53 Ga0097620_100133638 3300006931 Bacteria 2553
54 Ga0075435_100000010 3300007076 Bacteria 112658
55 Ga0075435_100002853 3300007076 Bacteria 11573
56 Ga0075435_100026271 3300007076 Bacteria 4540
57 Ga0075435_100069483 3300007076 Bacteria 2872
58 Ga0111539_10008764 3300009094 Bacteria 12826
59 Ga0111539_10248817 3300009094 Bacteria 2070
60 Ga0111539_10498448 3300009094 Unclassified 1418
61 Ga0105245_10130376 3300009098 Unclassified 2358
62 Ga0114129_10005827 3300009147 Bacteria 17453
63 Ga0114129_10036553 3300009147 Bacteria 6934
64 Ga0114129_10056243 3300009147 Bacteria 5511
65 Ga0114129_10086402 3300009147 Bacteria 4350
66 Ga0114129_10123063 3300009147 Bacteria 3568
67 Ga0114129_10178250 3300009147 Bacteria 2893
68 Ga0114129_10385194 3300009147 Unclassified 1851
69 Ga0105243_10013763 3300009148 Bacteria 6122
70 Ga0105242_10345800 3300009176 Bacteria 1372
71 Ga0105248_10027548 3300009177 Bacteria 6328
72 Ga0105249_10010238 3300009553 Bacteria 8235
73 Ga0105249_10033745 3300009553 Bacteria 4635
74 Ga0105249_10217082 3300009553 Bacteria 1880
75 Ga0157375_10033789 3300013308 Bacteria 4864
76 Ga0163163_10176122 3300014325 Bacteria 2185
77 Ga0157379_10060990 3300014968 Bacteria 3372
78 Ga0207697_10031888 3300025315 Bacteria 2156
79 Ga0207697_10032919 3300025315 Unclassified 2122
80 Ga0207699_10071586 3300025906 Bacteria 2121
81 Ga0207660_10242449 3300025917 Unclassified 1420
82 Ga0207646_10096713 3300025922 Bacteria 2645
83 Ga0207681_10090314 3300025923 Bacteria 2186
84 Ga0207650_10016655 3300025925 Bacteria 5138
85 Ga0207659_10014041 3300025926 Bacteria 5155
86 Ga0207686_10110773 3300025934 Bacteria 1851
87 Ga0207686_10165108 3300025934 Bacteria 1556
88 Ga0207686_10308441 3300025934 Unclassified 1178
89 Ga0207709_10043013 3300025935 Bacteria 2721
90 Ga0207669_10111024 3300025937 Bacteria 1837
91 Ga0207711_10016803 3300025941 Bacteria 6077
92 Ga0207689_10054053 3300025942 Unclassified 3308
93 Ga0207668_10184650 3300025972 Bacteria 1648
94 Ga0207658_10437667 3300025986 Bacteria 1156
95 Ga0207677_10141434 3300026023 Unclassified 1843
96 Ga0207677_10190023 3300026023 Bacteria 1623
97 Ga0207708_10193780 3300026075 Bacteria 1619
98 Ga0207641_10183727 3300026088 Unclassified 1917
99 Ga0207648_10016660 3300026089 Bacteria 6707
100 Ga0207676_10092919 3300026095 Bacteria 2482
101 Ga0207676_10179316 3300026095 Bacteria 1853
102 Ga0207675_100233010 3300026118 Bacteria 1777
103 Ga0207675_100662214 3300026118 Bacteria 1051
104 Ga0207683_10036900 3300026121 Bacteria 4256
105 Ga0207428_10038792 3300027907 Bacteria 3870
106 Ga0207428_10256195 3300027907 Bacteria 1304
107 Ga0268266_10128006 3300028379 Bacteria 2268
108 Ga0307408_100080007 3300031548 Bacteria 2440
109 Ga0307406_10374893 3300031901 Bacteria 1120
110 Ga0307412_10430647 3300031911 Bacteria 1081
111 Ga0307416_100064997 3300032002 Unclassified 2995
112 Ga0373925_0004430 3300037068 Bacteria 10610
113 Ga0436365_0085780 3300039437 Bacteria 3859
114 Ga0439440_0018868 3300042993 Bacteria 1532
115 Ga0451576_0248380 3300045051 Bacteria 1859
116 Ga0496102_0047166 3300048905 Bacteria 3914
117 Ga0496104_0006112 3300048907 Bacteria 10571
118 Ga0496108_0014057 3300048911 Bacteria 6532
119 Ga0496108_0017469 3300048911 Bacteria 5870
120 Ga0496109_0003771 3300048912 Bacteria 12662
121 Ga0496109_0230882 3300048912 Bacteria 1741
122 Ga0496112_0008530 3300048915 Bacteria 9183
123 Ga0496112_0197536 3300048915 Bacteria 1972
124 Ga0496112_0583043 3300048915 Bacteria 1051
125 Ga0496113_0016957 3300048916 Bacteria 5043
126 Ga0501291_021683 3300049514 Bacteria 1026
127 Ga0501043_0063354 3300049579 Bacteria 2904
128 Ga0501068_0098583 3300049584 Unclassified 1810
129 Ga0501073_0180442 3300049589 Bacteria 1461
130 nmdc:mga05p37_238309_c1 3300050507 Bacteria 2189
131 nmdc:mga05p37_295148_c1 3300050507 Bacteria 1928
132 nmdc:mga05p37_436188_c1 3300050507 Unclassified 1520
133 nmdc:mga09592_85444_c1 3300050508 Bacteria 2692
134 nmdc:mga06r32_67309_c1 3300050510 Bacteria 3458
135 nmdc:mga08y16_84387_c1 3300050511 Bacteria 3311
136 nmdc:mga0n895_101460_c1 3300050512 Bacteria 2888
137 nmdc:mga0n895_18049_c1 3300050512 Bacteria 6522
138 nmdc:mga0n895_48_c1 3300050512 Bacteria 73654
139 nmdc:mga0rr50_128158_c1 3300050513 Bacteria 2028
140 nmdc:mga0rr50_18_c1 3300050513 Bacteria 166751
141 nmdc:mga0rr50_48611_c1 3300050513 Bacteria 3137
142 nmdc:mga0rr50_5138_c1 3300050513 Bacteria 7772
143 nmdc:mga08x19_143_c1 3300050514 Bacteria 62934
144 nmdc:mga08x19_20223_c1 3300050514 Bacteria 4099
145 nmdc:mga08x19_22925_c1 3300050514 Bacteria 3871
146 nmdc:mga08x19_41740_c1 3300050514 Bacteria 2922
147 nmdc:mga08x19_45384_c1 3300050514 Bacteria 2809
148 nmdc:mga0a205_106771_c1 3300050515 Bacteria 2697
149 nmdc:mga0a205_244184_c1 3300050515 Unclassified 1676
150 Ga0590077_000246 3300059426 Bacteria 15406
151 Ga0501082_0329745 3300060353 Bacteria 1330
152 Ga0070674_100041307
153 Ga0065715_10000750
154 Ga0065715_10119130
155 Ga0070670_100091088
156 Ga0070670_100173711
157 Ga0068869_100062831
158 Ga0070680_100169070
159 Ga0068868_100117699
160 Ga0068868_100241701
161 Ga0070668_100310061
162 Ga0070669_100014837
163 Ga0070675_100058730
164 Ga0070674_100049026
165 Ga0070688_100023115
166 Ga0070688_100091167
167 Ga0070709_10242245
168 Ga0068867_100133826
169 Ga0070707_100130928
170 Ga0070698_100204243
171 Ga0070698_100204288
172 Ga0070698_100569712
173 Ga0070699_100027290
174 Ga0070699_100289964
175 Ga0070697_100087595
176 Ga0070672_100025193
177 Ga0070686_100151984
178 Ga0070695_100069187
179 Ga0070695_100423478
180 Ga0070696_100069361
181 Ga0070665_100016645
182 Ga0070704_100033793
183 Ga0068859_100133632
184 Ga0068864_100015817
185 Ga0068864_100174217
186 Ga0068864_100413039
187 Ga0068861_100045970
188 Ga0068858_100085155
189 Ga0068862_100057410
190 Ga0075365_10007232
191 Ga0097621_100111098
192 Ga0075428_100003866
193 Ga0075431_100191948
194 Ga0075433_10068142
195 Ga0075433_10143428
196 Ga0075434_100000022
197 Ga0075434_100032541
198 Ga0075434_100063025
199 Ga0075434_100071597
200 Ga0075429_100083762
201 Ga0075436_100001549
202 Ga0075436_100015087
203 Ga0075436_100026319
204 Ga0097620_100133638
205 Ga0075435_100000010
206 Ga0075435_100002853
207 Ga0075435_100026271
208 Ga0075435_100069483
209 Ga0111539_10008764
210 Ga0111539_10248817
211 Ga0111539_10498448
212 Ga0105245_10130376
213 Ga0114129_10005827
214 Ga0114129_10036553
215 Ga0114129_10056243
216 Ga0114129_10086402
217 Ga0114129_10123063
218 Ga0114129_10178250
219 Ga0114129_10385194
220 Ga0105243_10013763
221 Ga0105242_10345800
222 Ga0105248_10027548
223 Ga0105249_10010238
224 Ga0105249_10033745
225 Ga0105249_10217082
226 Ga0157375_10033789
227 Ga0163163_10176122
228 Ga0157379_10060990
229 Ga0207697_10031888
230 Ga0207697_10032919
231 Ga0207699_10071586
232 Ga0207660_10242449
233 Ga0207646_10096713
234 Ga0207681_10090314
235 Ga0207650_10016655
236 Ga0207659_10014041
237 Ga0207686_10110773
238 Ga0207686_10165108
239 Ga0207686_10308441
240 Ga0207709_10043013
241 Ga0207669_10111024
242 Ga0207711_10016803
243 Ga0207689_10054053
244 Ga0207668_10184650
245 Ga0207658_10437667
246 Ga0207677_10141434
247 Ga0207677_10190023
248 Ga0207708_10193780
249 Ga0207641_10183727
250 Ga0207648_10016660
251 Ga0207676_10092919
252 Ga0207676_10179316
253 Ga0207675_100233010
254 Ga0207675_100662214
255 Ga0207683_10036900
256 Ga0207428_10038792
257 Ga0207428_10256195
258 Ga0268266_10128006
259 Ga0307408_100080007
260 Ga0307406_10374893
261 Ga0307412_10430647
262 Ga0307416_100064997
263 Ga0373925_0004430
264 Ga0436365_0085780
265 Ga0439440_0018868
266 Ga0451576_0248380
267 Ga0496102_0047166
268 Ga0496104_0006112
269 Ga0496108_0014057
270 Ga0496108_0017469
271 Ga0496109_0003771
272 Ga0496109_0230882
273 Ga0496112_0008530
274 Ga0496112_0197536
275 Ga0496112_0583043
276 Ga0496113_0016957
277 Ga0501291_021683
278 Ga0501043_0063354
279 Ga0501068_0098583
280 Ga0501073_0180442
281 nmdc:mga05p37_238309_c1
282 nmdc:mga05p37_295148_c1
283 nmdc:mga05p37_436188_c1
284 nmdc:mga09592_85444_c1
285 nmdc:mga06r32_67309_c1
286 nmdc:mga08y16_84387_c1
287 nmdc:mga0n895_101460_c1
288 nmdc:mga0n895_18049_c1
289 nmdc:mga0n895_48_c1
290 nmdc:mga0rr50_128158_c1
291 nmdc:mga0rr50_18_c1
292 nmdc:mga0rr50_48611_c1
293 nmdc:mga0rr50_5138_c1
294 nmdc:mga08x19_143_c1
295 nmdc:mga08x19_20223_c1
296 nmdc:mga08x19_22925_c1
297 nmdc:mga08x19_41740_c1
298 nmdc:mga08x19_45384_c1
299 nmdc:mga0a205_106771_c1
300 nmdc:mga0a205_244184_c1
301 Ga0590077_000246
302 Ga0501082_0329745

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01979

Amidohydro_1

Amidohydrolase family

49

367

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vhl-assembly2.cif.gz_B the three-dimensional structure of the n-acetylglucosamine-6- phosphate deacetylase from bacillus subtilis 0.9001 38 353
2p53-assembly1.cif.gz_B crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d273n mutant complexed with n-acetyl phosphonamidate-d-glucosamine-6-phosphate 0.8857 37 360
6fv4-assembly1.cif.gz_A the structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d267a mutant from mycobacterium smegmatis in complex with n-acetyl-d-glucosamine-6-phosphate 0.8831 38 356
2p50-assembly1.cif.gz_A crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn 0.8779 37 360
7nuu-assembly1.cif.gz_A crystal structure of human amdhd2 in complex with zn 0.8732 40 360
ID Description Score Start End Superfamily
2vhlA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9265 43 336 3.20.20.140
af_Q2G2U0_63_361_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9261 43 336 3.20.20.140
af_Q2G2U0_63_361_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9085 43 336 3.20.20.140
2vhlA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9026 43 336 3.20.20.140
af_O53382_52_348_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8963 43 336 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A2V7TSI4-F1-model_v4 N-acetylglucosamine-6-phosphate deacetylase 0.9739 38 358 GO:0006046
GO:0008448
AF-A0A2V8GCL0-F1-model_v4 N-acetylglucosamine-6-phosphate deacetylase 0.9707 252 360 GO:0006046
GO:0008448
AF-A0A7C2EW24-F1-model_v4 Uncharacterized protein 0.9695 41 205 GO:0006046
GO:0008448
AF-A0A7X8CTF4-F1-model_v4 N-acetylglucosamine-6-phosphate deacetylase 0.9663 41 206 GO:0006046
GO:0008448
AF-A0A7V3D568-F1-model_v4 N-acetylglucosamine-6-phosphate deacetylase 0.9627 41 199 GO:0006046
GO:0008448

Map