F209898

General Info

Members Datasets Scaffolds Average Seq Length
150 104 150 265

Family's Representative Sequence

Representative Sequence 3300049579|Ga0501043_0017305|Ga0501043_0017305_2291_3202
Length 293
Sequence MSQPPTKQHAGPTGGESPSVQRGSGCPVADAQICLVDLHKSFGSLVVFNGLNLTIREHECLVVLGPSGTGKSVLLKHIVGLLRPDSGEVWFHDQRVDLLDERGLEPIRRQFGVLFQGGALFDSMTVYENIAFPLREHGDFQEPEIRDRVAQKLAMVGLDGTQEKIPAELSGGMRKRVALARAIALNPEVVLYDEPTTGLDPIRSDIINELILKLNDEMRVTSVVVTHDMASAFKVADRLVMLSEGRVIAEGNAESFRQSTNEEVRRFVEGRASPSELAALNRGAEGAVGEKAE

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
67 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
72 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
73 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
74 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
75 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
76 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
77 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
78 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
79 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
80 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
81 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
82 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
83 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
84 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
85 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
86 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
87 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
88 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
89 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
90 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
98 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
99 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
100 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
101 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
103 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
104 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10067071 3300005327 Bacteria 2932
2 Ga0070658_10126785 3300005327 Bacteria 2125
3 Ga0070658_10293867 3300005327 Bacteria 1385
4 Ga0070658_10310238 3300005327 Bacteria 1346
5 Ga0070670_100144921 3300005331 Bacteria 2055
6 Ga0070666_10086555 3300005335 Bacteria 2147
7 Ga0070668_100243708 3300005347 Bacteria 1490
8 Ga0070669_100626560 3300005353 Bacteria 903
9 Ga0070675_100006057 3300005354 Bacteria 9264
10 Ga0070675_100087276 3300005354 Bacteria 2609
11 Ga0070671_100278393 3300005355 Bacteria 1423
12 Ga0070673_100122447 3300005364 Bacteria 2172
13 Ga0070673_100507856 3300005364 Bacteria 1091
14 Ga0070714_100046488 3300005435 Unclassified 3683
15 Ga0070713_100141175 3300005436 Bacteria 2134
16 Ga0070713_100194302 3300005436 Unclassified 1830
17 Ga0070678_100765998 3300005456 Bacteria 874
18 Ga0070662_100695627 3300005457 Bacteria 860
19 Ga0070684_100461763 3300005535 Bacteria 1174
20 Ga0070672_100029107 3300005543 Bacteria 4139
21 Ga0070696_100136856 3300005546 Bacteria 1786
22 Ga0070665_100000313 3300005548 Bacteria 75686
23 Ga0070665_100003600 3300005548 Bacteria 16407
24 Ga0070665_100095679 3300005548 Bacteria 2975
25 Ga0068855_100098169 3300005563 Bacteria 3374
26 Ga0068855_100522863 3300005563 Bacteria 1287
27 Ga0068857_100008634 3300005577 Bacteria 8817
28 Ga0068857_100281132 3300005577 Bacteria 1531
29 Ga0068852_100380231 3300005616 Bacteria 1385
30 Ga0068864_100199534 3300005618 Bacteria 1837
31 Ga0068863_100280695 3300005841 Bacteria 1614
32 Ga0068863_100401822 3300005841 Bacteria 1340
33 Ga0068858_100213480 3300005842 Bacteria 1826
34 Ga0068858_100369920 3300005842 Bacteria 1375
35 Ga0068860_100195422 3300005843 Bacteria 1959
36 Ga0068860_100489145 3300005843 Bacteria 1227
37 Ga0097621_100524960 3300006237 Bacteria 1075
38 Ga0075428_100092196 3300006844 Bacteria 3303
39 Ga0075430_100018091 3300006846 Bacteria 5997
40 Ga0075431_100275638 3300006847 Bacteria 1703
41 Ga0075433_10057744 3300006852 Bacteria 3393
42 Ga0105240_10199137 3300009093 Bacteria 2349
43 Ga0105240_10287487 3300009093 Unclassified 1886
44 Ga0111539_10039834 3300009094 Bacteria 5660
45 Ga0105245_10003590 3300009098 Bacteria 13843
46 Ga0105241_10032069 3300009174 Bacteria 3936
47 Ga0105248_10367019 3300009177 Bacteria 1621
48 Ga0105239_10033606 3300010375 Bacteria 5632
49 Ga0105239_10352493 3300010375 Bacteria 1662
50 Ga0157371_10262269 3300013102 Bacteria 1246
51 Ga0157370_10078465 3300013104 Bacteria 3109
52 Ga0157370_10080139 3300013104 Bacteria 3074
53 Ga0157369_10057016 3300013105 Bacteria 4215
54 Ga0157369_10461112 3300013105 Bacteria 1316
55 Ga0157369_10907930 3300013105 Bacteria 903
56 Ga0157374_10042141 3300013296 Bacteria 4210
57 Ga0157374_10350450 3300013296 Bacteria 1467
58 Ga0163162_10223301 3300013306 Bacteria 2013
59 Ga0157372_10053256 3300013307 Bacteria 4509
60 Ga0157372_10126163 3300013307 Bacteria 2943
61 Ga0157372_10236081 3300013307 Bacteria 2121
62 Ga0157372_10399628 3300013307 Bacteria 1601
63 Ga0157372_10538400 3300013307 Bacteria 1361
64 Ga0157372_10672270 3300013307 Bacteria 1205
65 Ga0157372_10826484 3300013307 Bacteria 1076
66 Ga0157379_10889647 3300014968 Bacteria 844
67 Ga0207680_10186329 3300025903 Bacteria 1406
68 Ga0207647_10160165 3300025904 Bacteria 1313
69 Ga0207705_10004915 3300025909 Bacteria 10033
70 Ga0207695_10000147 3300025913 Bacteria 208929
71 Ga0207695_10296182 3300025913 Bacteria 1509
72 Ga0207671_10294448 3300025914 Bacteria 1282
73 Ga0207657_10336681 3300025919 Bacteria 1191
74 Ga0207659_10007509 3300025926 Bacteria 6709
75 Ga0207659_10062680 3300025926 Bacteria 2684
76 Ga0207700_10113704 3300025928 Bacteria 2183
77 Ga0207664_10068993 3300025929 Unclassified 2842
78 Ga0207644_10154347 3300025931 Bacteria 1779
79 Ga0207691_10009374 3300025940 Bacteria 9399
80 Ga0207667_10342196 3300025949 Bacteria 1526
81 Ga0207651_10098919 3300025960 Bacteria 2159
82 Ga0207703_10181234 3300026035 Bacteria 1859
83 Ga0207702_10173328 3300026078 Bacteria 1980
84 Ga0207641_10153768 3300026088 Bacteria 2086
85 Ga0207676_10143731 3300026095 Bacteria 2046
86 Ga0207676_10176590 3300026095 Bacteria 1866
87 Ga0207674_10032574 3300026116 Bacteria 5465
88 Ga0207698_10407896 3300026142 Bacteria 1300
89 Ga0207698_10492368 3300026142 Bacteria 1191
90 Ga0207428_10050062 3300027907 Bacteria 3343
91 Ga0268266_10001857 3300028379 Bacteria 23860
92 Ga0268266_10004054 3300028379 Bacteria 14160
93 Ga0268266_10245158 3300028379 Bacteria 1655
94 Ga0268266_10389238 3300028379 Bacteria 1316
95 Ga0265338_10027326 3300028800 Bacteria 5728
96 Ga0265339_10022059 3300031249 Bacteria 3693
97 Ga0265316_10134484 3300031344 Bacteria 1861
98 Ga0265316_10143141 3300031344 Bacteria 1795
99 Ga0265313_10135480 3300031595 Bacteria 1063
100 Ga0265314_10006905 3300031711 Bacteria 9943
101 Ga0307409_100144060 3300031995 Bacteria 2057
102 Ga0307409_100666996 3300031995 Bacteria 1036
103 Ga0307416_100636977 3300032002 Bacteria 1149
104 Ga0373937_0043766 3300036401 Bacteria 4089
105 Ga0373937_0599604 3300036401 Bacteria 1046
106 Ga0395905_0888132 3300037471 Bacteria 794
107 Ga0395901_0347074 3300038443 Bacteria 1532
108 Ga0451576_0002491 3300045051 Bacteria 27345
109 Ga0495629_0071806 3300046459 Bacteria 2416
110 Ga0495582_0137385 3300046473 Bacteria 1384
111 Ga0495664_0144610 3300046477 Bacteria 1442
112 Ga0495618_0174056 3300046514 Bacteria 1369
113 Ga0495630_0000704 3300046517 Bacteria 23798
114 Ga0495652_0100578 3300046529 Unclassified 2345
115 Ga0495665_0088753 3300046531 Bacteria 1625
116 Ga0495667_0051151 3300046559 Bacteria 2726
117 Ga0495635_0133577 3300046663 Bacteria 1692
118 Ga0495613_0009900 3300046689 Bacteria 7087
119 Ga0495649_0038078 3300046694 Bacteria 2640
120 Ga0495636_0050642 3300047318 Bacteria 1739
121 Ga0495674_0100973 3300047319 Bacteria 2455
122 Ga0495680_0394158 3300047322 Bacteria 957
123 Ga0495684_0004440 3300047471 Bacteria 10964
124 Ga0495684_0006066 3300047471 Bacteria 9394
125 Ga0495684_0136265 3300047471 Bacteria 1842
126 Ga0495686_0058814 3300047472 Bacteria 2395
127 Ga0501034_0000148 3300049571 Bacteria 131931
128 Ga0501034_0002250 3300049571 Bacteria 23728
129 Ga0501034_0003217 3300049571 Bacteria 18699
130 Ga0501036_0104513 3300049572 Bacteria 2395
131 Ga0501037_0010784 3300049573 Bacteria 6716
132 Ga0501038_0001064 3300049574 Bacteria 24784
133 Ga0501043_0017305 3300049579 Bacteria 5655
134 Ga0501043_0124472 3300049579 Bacteria 2022
135 Ga0501046_0000007 3300049580 Bacteria 356002
136 Ga0501047_0200078 3300049581 Bacteria 1859
137 Ga0501047_0360430 3300049581 Bacteria 1290
138 Ga0501073_0112051 3300049589 Bacteria 1892
139 Ga0501076_0085278 3300049592 Bacteria 2538
140 Ga0501080_0020219 3300049742 Bacteria 6163
141 Ga0501083_0000032 3300049744 Bacteria 102761
142 Ga0501083_0029325 3300049744 Bacteria 3786
143 Ga0501035_0039904 3300049822 Bacteria 4245
144 Ga0501035_0179303 3300049822 Bacteria 1826
145 Ga0501044_0000363 3300049823 Bacteria 56867
146 Ga0501044_0003756 3300049823 Bacteria 17070
147 Ga0501044_0049585 3300049823 Bacteria 4334
148 Ga0501044_0202140 3300049823 Bacteria 1945
149 nmdc:mga06r32_165266_c1 3300050510 Bacteria 2196
150 nmdc:mga08y16_27151_c1 3300050511 Bacteria 6033

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005546 Ga0070696_100136856 Ga0070696_1001368561 246
2 3300006852 Ga0075433_10057744 Ga0075433_100577443 246
3 3300005548 Ga0070665_100000313 Ga0070665_10000031316 250
4 3300028379 Ga0268266_10001857 Ga0268266_100018573 250
5 3300031344 Ga0265316_10134484 Ga0265316_101344842 251
6 3300005327 Ga0070658_10293867 Ga0070658_102938673 252
7 3300005347 Ga0070668_100243708 Ga0070668_1002437081 252
8 3300009177 Ga0105248_10367019 Ga0105248_103670192 252
9 3300031595 Ga0265313_10135480 Ga0265313_101354802 252
10 3300037471 Ga0395905_0888132 Ga0395905_0888132_13_771 252
11 3300046473 Ga0495582_0137385 Ga0495582_0137385_105_923 252
12 3300049581 Ga0501047_0360430 Ga0501047_0360430_70_828 252
13 3300005335 Ga0070666_10086555 Ga0070666_100865553 253
14 3300005353 Ga0070669_100626560 Ga0070669_1006265602 253
15 3300005354 Ga0070675_100087276 Ga0070675_1000872762 253
16 3300005364 Ga0070673_100122447 Ga0070673_1001224471 253
17 3300005364 Ga0070673_100507856 Ga0070673_1005078562 253
18 3300005456 Ga0070678_100765998 Ga0070678_1007659981 253
19 3300005457 Ga0070662_100695627 Ga0070662_1006956271 253
20 3300005616 Ga0068852_100380231 Ga0068852_1003802312 253
21 3300005841 Ga0068863_100280695 Ga0068863_1002806952 253
22 3300006237 Ga0097621_100524960 Ga0097621_1005249601 253
23 3300013306 Ga0163162_10223301 Ga0163162_102233011 253
24 3300013307 Ga0157372_10538400 Ga0157372_105384002 253
25 3300013307 Ga0157372_10672270 Ga0157372_106722701 253
26 3300025903 Ga0207680_10186329 Ga0207680_101863292 253
27 3300025919 Ga0207657_10336681 Ga0207657_103366812 253
28 3300025926 Ga0207659_10062680 Ga0207659_100626802 253
29 3300026095 Ga0207676_10143731 Ga0207676_101437312 253
30 3300026142 Ga0207698_10492368 Ga0207698_104923681 253
31 3300031995 Ga0307409_100144060 Ga0307409_1001440602 253
32 3300031995 Ga0307409_100666996 Ga0307409_1006669961 253
33 3300032002 Ga0307416_100636977 Ga0307416_1006369771 253
34 3300038443 Ga0395901_0347074 Ga0395901_0347074_266_1027 253
35 3300046459 Ga0495629_0071806 Ga0495629_0071806_898_1659 253
36 3300046663 Ga0495635_0133577 Ga0495635_0133577_786_1547 253
37 3300047471 Ga0495684_0136265 Ga0495684_0136265_155_916 253
38 3300049823 Ga0501044_0049585 Ga0501044_0049585_2065_2832 253
39 3300005327 Ga0070658_10067071 Ga0070658_100670712 254
40 3300005327 Ga0070658_10126785 Ga0070658_101267852 254
41 3300005327 Ga0070658_10310238 Ga0070658_103102382 254
42 3300005331 Ga0070670_100144921 Ga0070670_1001449212 254
43 3300005354 Ga0070675_100006057 Ga0070675_1000060573 254
44 3300005355 Ga0070671_100278393 Ga0070671_1002783932 254
45 3300005435 Ga0070714_100046488 Ga0070714_1000464883 254
46 3300005436 Ga0070713_100141175 Ga0070713_1001411752 254
47 3300005436 Ga0070713_100194302 Ga0070713_1001943022 254
48 3300005535 Ga0070684_100461763 Ga0070684_1004617631 254
49 3300005543 Ga0070672_100029107 Ga0070672_1000291075 254
50 3300005548 Ga0070665_100003600 Ga0070665_1000036002 254
51 3300005548 Ga0070665_100095679 Ga0070665_1000956792 254
52 3300005563 Ga0068855_100098169 Ga0068855_1000981692 254
53 3300005563 Ga0068855_100522863 Ga0068855_1005228632 254
54 3300005577 Ga0068857_100008634 Ga0068857_10000863410 254
55 3300005577 Ga0068857_100281132 Ga0068857_1002811322 254
56 3300005618 Ga0068864_100199534 Ga0068864_1001995342 254
57 3300005841 Ga0068863_100401822 Ga0068863_1004018222 254
58 3300005842 Ga0068858_100213480 Ga0068858_1002134803 254
59 3300005842 Ga0068858_100369920 Ga0068858_1003699202 254
60 3300005843 Ga0068860_100195422 Ga0068860_1001954222 254
61 3300005843 Ga0068860_100489145 Ga0068860_1004891452 254
62 3300006844 Ga0075428_100092196 Ga0075428_1000921964 254
63 3300006846 Ga0075430_100018091 Ga0075430_1000180913 254
64 3300006847 Ga0075431_100275638 Ga0075431_1002756382 254
65 3300009093 Ga0105240_10199137 Ga0105240_101991372 254
66 3300009093 Ga0105240_10287487 Ga0105240_102874872 254
67 3300009094 Ga0111539_10039834 Ga0111539_100398345 254
68 3300009098 Ga0105245_10003590 Ga0105245_1000359011 254
69 3300009174 Ga0105241_10032069 Ga0105241_100320695 254
70 3300010375 Ga0105239_10033606 Ga0105239_100336063 254
71 3300010375 Ga0105239_10352493 Ga0105239_103524932 254
72 3300013102 Ga0157371_10262269 Ga0157371_102622691 254
73 3300013104 Ga0157370_10078465 Ga0157370_100784651 254
74 3300013104 Ga0157370_10080139 Ga0157370_100801392 254
75 3300013105 Ga0157369_10057016 Ga0157369_100570163 254
76 3300013105 Ga0157369_10461112 Ga0157369_104611122 254
77 3300013105 Ga0157369_10907930 Ga0157369_109079301 254
78 3300013296 Ga0157374_10042141 Ga0157374_100421412 254
79 3300013296 Ga0157374_10350450 Ga0157374_103504502 254
80 3300013307 Ga0157372_10053256 Ga0157372_100532564 254
81 3300013307 Ga0157372_10126163 Ga0157372_101261632 254
82 3300013307 Ga0157372_10236081 Ga0157372_102360814 254
83 3300013307 Ga0157372_10399628 Ga0157372_103996282 254
84 3300013307 Ga0157372_10826484 Ga0157372_108264842 254
85 3300014968 Ga0157379_10889647 Ga0157379_108896471 254
86 3300025904 Ga0207647_10160165 Ga0207647_101601652 254
87 3300025909 Ga0207705_10004915 Ga0207705_100049152 254
88 3300025913 Ga0207695_10000147 Ga0207695_1000014791 254
89 3300025913 Ga0207695_10296182 Ga0207695_102961822 254
90 3300025914 Ga0207671_10294448 Ga0207671_102944482 254
91 3300025926 Ga0207659_10007509 Ga0207659_100075093 254
92 3300025928 Ga0207700_10113704 Ga0207700_101137042 254
93 3300025929 Ga0207664_10068993 Ga0207664_100689933 254
94 3300025931 Ga0207644_10154347 Ga0207644_101543472 254
95 3300025940 Ga0207691_10009374 Ga0207691_100093742 254
96 3300025949 Ga0207667_10342196 Ga0207667_103421961 254
97 3300025960 Ga0207651_10098919 Ga0207651_100989192 254
98 3300026035 Ga0207703_10181234 Ga0207703_101812343 254
99 3300026078 Ga0207702_10173328 Ga0207702_101733282 254
100 3300026088 Ga0207641_10153768 Ga0207641_101537682 254
101 3300026095 Ga0207676_10176590 Ga0207676_101765901 254
102 3300026116 Ga0207674_10032574 Ga0207674_100325745 254
103 3300026142 Ga0207698_10407896 Ga0207698_104078962 254
104 3300027907 Ga0207428_10050062 Ga0207428_100500623 254
105 3300028379 Ga0268266_10004054 Ga0268266_100040542 254
106 3300028379 Ga0268266_10245158 Ga0268266_102451582 254
107 3300028379 Ga0268266_10389238 Ga0268266_103892382 254
108 3300028800 Ga0265338_10027326 Ga0265338_100273263 254
109 3300031249 Ga0265339_10022059 Ga0265339_100220593 254
110 3300031344 Ga0265316_10143141 Ga0265316_101431412 254
111 3300031711 Ga0265314_10006905 Ga0265314_100069053 254
112 3300036401 Ga0373937_0043766 Ga0373937_0043766_2511_3290 254
113 3300036401 Ga0373937_0599604 Ga0373937_0599604_157_942 254
114 3300045051 Ga0451576_0002491 Ga0451576_0002491_25626_26477 254
115 3300046477 Ga0495664_0144610 Ga0495664_0144610_566_1423 254
116 3300046514 Ga0495618_0174056 Ga0495618_0174056_398_1255 254
117 3300046517 Ga0495630_0000704 Ga0495630_0000704_20367_21191 254
118 3300046529 Ga0495652_0100578 Ga0495652_0100578_681_1460 254
119 3300046531 Ga0495665_0088753 Ga0495665_0088753_372_1196 254
120 3300046559 Ga0495667_0051151 Ga0495667_0051151_1650_2507 254
121 3300046689 Ga0495613_0009900 Ga0495613_0009900_3347_4204 254
122 3300046694 Ga0495649_0038078 Ga0495649_0038078_973_1896 254
123 3300047318 Ga0495636_0050642 Ga0495636_0050642_733_1512 254
124 3300047319 Ga0495674_0100973 Ga0495674_0100973_370_1155 254
125 3300047322 Ga0495680_0394158 Ga0495680_0394158_65_922 254
126 3300047471 Ga0495684_0004440 Ga0495684_0004440_205_1029 254
127 3300047471 Ga0495684_0006066 Ga0495684_0006066_525_1382 254
128 3300047472 Ga0495686_0058814 Ga0495686_0058814_1538_2326 254
129 3300049571 Ga0501034_0000148 Ga0501034_0000148_45206_46051 254
130 3300049571 Ga0501034_0002250 Ga0501034_0002250_14435_15229 254
131 3300049571 Ga0501034_0003217 Ga0501034_0003217_15602_16384 254
132 3300049572 Ga0501036_0104513 Ga0501036_0104513_833_1648 254
133 3300049573 Ga0501037_0010784 Ga0501037_0010784_1402_2196 254
134 3300049574 Ga0501038_0001064 Ga0501038_0001064_15549_16364 254
135 3300049579 Ga0501043_0017305 Ga0501043_0017305_2291_3202 254
136 3300049579 Ga0501043_0124472 Ga0501043_0124472_1118_1939 254
137 3300049580 Ga0501046_0000007 Ga0501046_0000007_55694_56605 254
138 3300049581 Ga0501047_0200078 Ga0501047_0200078_90_911 254
139 3300049589 Ga0501073_0112051 Ga0501073_0112051_721_1554 254
140 3300049592 Ga0501076_0085278 Ga0501076_0085278_670_1479 254
141 3300049742 Ga0501080_0020219 Ga0501080_0020219_3525_4307 254
142 3300049744 Ga0501083_0000032 Ga0501083_0000032_62526_63437 254
143 3300049744 Ga0501083_0029325 Ga0501083_0029325_2295_3077 254
144 3300049822 Ga0501035_0039904 Ga0501035_0039904_1074_1985 254
145 3300049822 Ga0501035_0179303 Ga0501035_0179303_143_937 254
146 3300049823 Ga0501044_0000363 Ga0501044_0000363_2844_3626 254
147 3300049823 Ga0501044_0003756 Ga0501044_0003756_1792_2589 254
148 3300049823 Ga0501044_0202140 Ga0501044_0202140_727_1548 254
149 3300050510 nmdc:mga06r32_165266_c1 nmdc:mga06r32_165266_c1_14_832 254
150 3300050511 nmdc:mga08y16_27151_c1 nmdc:mga08y16_27151_c1_2417_3355 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

48

197

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ch8-assembly1.cif.gz_I cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9674 1 241
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.9643 1 241
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.961 1 223
8tzj-assembly1.cif.gz_A cryo-em structure of vibrio cholerae ftse/ftsx complex 0.9598 3 219
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.959 4 223
ID Description Score Start End Superfamily
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9838 1 244 3.40.50.300
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9681 1 244 3.40.50.300
af_O05779_1_226_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9632 3 224 3.40.50.300
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9598 1 223 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9591 2 223 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A355FUD0-F1-model_v4 ABC transporter ATP-binding protein 0.9851 4 225 GO:0005524
GO:0016887
AF-A0A7W1IP78-F1-model_v4 ATP-binding cassette domain-containing protein 0.9802 27 242 GO:0005524
GO:0016887
AF-A0A3C0PHH4-F1-model_v4 ABC transporter ATP-binding protein 0.9798 2 242 GO:0005524
GO:0016887
AF-A0A377GL99-F1-model_v4 Uncharacterized ABC transporter ATP-binding protein HI_1087 0.9754 1 241 GO:0005524
GO:0016887
AF-A0A0G0Y5F6-F1-model_v4 Cell division ATP-binding protein FtsE 0.9732 4 224 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0051301

Feature Viewer

pLDDT pTM Quality
91.69 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map