F208220

General Info

Members Datasets Scaffolds Average Seq Length
150 100 300 258

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100143425|Ga0070698_1001434252
Length 295
Sequence LPPLIYRTIGDVLAEVDNDPAGRSHRHRKHCTIDLMDLSIVIPVKNEADNVASLVGEIRAALEGLIAYEILYVDDGSDDATASEISRFGGTAPQVRLLRHTRNYGQSAAIGTGVHAARGAWIATLDGDGQNDPADLPAMWHLAQQASPGPPLLIAGYRERRRDSWSKRVASRIANGIRAQLLGDRTPDTGCGLKLFPRSLFLDLPYFDHMHRFLPALVLREGGTVLSVAVNHRPRHKGMSKYGVFDRLGVGIIDLLGVMWLQRRAPRPHPFHEVILAPEPSAADDPRLSAIATVR

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
29 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
30 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
31 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
32 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
33 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
34 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
35 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
36 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
50 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
51 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
52 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
53 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
54 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
55 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
56 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
57 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
58 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
59 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
60 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
61 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
62 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
63 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
64 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
65 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
66 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
67 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
68 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
69 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
70 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
73 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
74 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
75 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
76 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
77 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
78 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
79 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
84 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
85 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
86 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
87 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
88 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
89 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
90 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
92 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
93 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
94 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
95 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
96 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
97 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
98 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
99 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
100 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 0
Isolates 1.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 0
Rhizoplane 1.33
Rhizosphere 84.67
Stem 0
Stem Tuber 0
Unclassified 1.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100143425 3300005471 Bacteria 2339
2 Ga0070683_100024416 3300005329 Bacteria 5414
3 Ga0070680_100069604 3300005336 Bacteria 2890
4 Ga0070661_100011614 3300005344 Bacteria 6139
5 Ga0070659_100013599 3300005366 Bacteria 6062
6 Ga0070709_10010376 3300005434 Bacteria 5158
7 Ga0070714_100051881 3300005435 Bacteria 3498
8 Ga0070714_100053857 3300005435 Bacteria 3436
9 Ga0070714_100933816 3300005435 Bacteria 843
10 Ga0070713_100023962 3300005436 Bacteria 4746
11 Ga0070713_100169109 3300005436 Bacteria 1957
12 Ga0070710_10356348 3300005437 Unclassified 970
13 Ga0070711_100003711 3300005439 Bacteria 8947
14 Ga0070711_100134026 3300005439 Bacteria 1849
15 Ga0070681_10001611 3300005458 Bacteria 20094
16 Ga0070681_10055274 3300005458 Bacteria 3953
17 Ga0070706_100017732 3300005467 Bacteria 6570
18 Ga0070706_100039720 3300005467 Bacteria 4343
19 Ga0070707_100026835 3300005468 Bacteria 5472
20 Ga0070679_100029559 3300005530 Bacteria 5407
21 Ga0070684_100036002 3300005535 Bacteria 4240
22 Ga0070697_100028769 3300005536 Bacteria 4452
23 Ga0070686_100184399 3300005544 Bacteria 1485
24 Ga0070664_100008453 3300005564 Bacteria 8324
25 Ga0068854_100434444 3300005578 Bacteria 1093
26 Ga0068856_100129755 3300005614 Bacteria 2525
27 Ga0068851_10003424 3300005834 Bacteria 7063
28 Ga0081540_1018291 3300005983 Bacteria 4305
29 Ga0070717_10001680 3300006028 Bacteria 15390
30 Ga0070717_10085247 3300006028 Bacteria 2658
31 Ga0070712_100013961 3300006175 Bacteria 5145
32 Ga0070712_100020802 3300006175 Bacteria 4298
33 Ga0070712_100046247 3300006175 Bacteria 3008
34 Ga0070712_100158078 3300006175 Bacteria 1748
35 Ga0070712_100180416 3300006175 Bacteria 1645
36 Ga0075436_100020424 3300006914 Bacteria 4546
37 Ga0075435_100142193 3300007076 Bacteria 2014
38 Ga0114129_10071142 3300009147 Bacteria 4850
39 Ga0099796_10001667 3300010159 Bacteria 4600
40 Ga0182008_10044432 3300014497 Bacteria 2209
41 Ga0182008_10166145 3300014497 Bacteria 1113
42 Ga0213873_10028075 3300021358 Bacteria 1377
43 Ga0213872_10074049 3300021361 Bacteria 1533
44 Ga0213872_10147842 3300021361 Bacteria 1028
45 Ga0213874_10023815 3300021377 Bacteria 1712
46 Ga0213876_10162251 3300021384 Bacteria 1189
47 Ga0213875_10000091 3300021388 Bacteria 104903
48 Ga0213875_10002063 3300021388 Bacteria 12325
49 Ga0213875_10004285 3300021388 Bacteria 7855
50 Ga0213871_10003069 3300021441 Bacteria 3170
51 Ga0207699_10364791 3300025906 Bacteria 1022
52 Ga0207684_10010973 3300025910 Bacteria 7942
53 Ga0207707_10042548 3300025912 Bacteria 3964
54 Ga0207693_10005024 3300025915 Bacteria 11103
55 Ga0207693_10010152 3300025915 Bacteria 7648
56 Ga0207663_10054917 3300025916 Bacteria 2496
57 Ga0207660_10045151 3300025917 Bacteria 3103
58 Ga0207652_10061195 3300025921 Bacteria 3250
59 Ga0207646_10002543 3300025922 Bacteria 21532
60 Ga0207700_10013763 3300025928 Bacteria 5277
61 Ga0207700_10042627 3300025928 Bacteria 3329
62 Ga0207664_10060381 3300025929 Bacteria 3021
63 Ga0207664_10308176 3300025929 Bacteria 1395
64 Ga0207665_10130614 3300025939 Bacteria 1783
65 Ga0207665_10300497 3300025939 Bacteria 1200
66 Ga0316576_10000612 3300031727 Bacteria 17163
67 Ga0316576_10018216 3300031727 Bacteria 4789
68 Ga0316576_10187648 3300031727 Bacteria 1559
69 Ga0307416_100229528 3300032002 Unclassified 1788
70 Ga0316580_10020789 3300032139 Bacteria 2022
71 Ga0373926_0062448 3300035083 Bacteria 1360
72 Ga0373944_0010401 3300035089 Bacteria 2536
73 Ga0373923_0014185 3300035111 Bacteria 2988
74 Ga0373953_0001225 3300035117 Bacteria 7318
75 Ga0373954_0016607 3300035118 Bacteria 3297
76 Ga0373946_0059760 3300035171 Bacteria 1619
77 Ga0373955_0190328 3300035172 Bacteria 1220
78 Ga0316574_0098036 3300035398 Bacteria 1874
79 Ga0373935_0081398 3300035692 Bacteria 2105
80 Ga0373927_0042151 3300035695 Bacteria 2958
81 Ga0373933_0029248 3300035724 Bacteria 3184
82 Ga0373947_0024420 3300035725 Bacteria 3522
83 Ga0373947_0073170 3300035725 Bacteria 2106
84 Ga0373937_0027926 3300036401 Bacteria 5105
85 Ga0373937_0045168 3300036401 Bacteria 4025
86 Ga0373937_0094853 3300036401 Bacteria 2766
87 Ga0316584_0178980 3300036712 Bacteria 1570
88 Ga0373925_0272217 3300037068 Bacteria 1362
89 Ga0373925_0335195 3300037068 Bacteria 1226
90 Ga0436364_0408678 3300037853 Bacteria 3003
91 Ga0436364_0512396 3300037853 Bacteria 1860
92 Ga0436364_0831545 3300037853 Bacteria 29809
93 Ga0436364_1094263 3300037853 Bacteria 18660
94 Ga0436364_1193191 3300037853 Bacteria 15306
95 Ga0436365_0203373 3300039437 Bacteria 2331
96 Ga0436365_0296555 3300039437 Bacteria 4184
97 Ga0436365_1368074 3300039437 Bacteria 1250
98 Ga0436365_1661793 3300039437 Bacteria 1923
99 Ga0436360_0609818 3300039438 Bacteria 801
100 Ga0436360_1237108 3300039438 Bacteria 968
101 Ga0436361_0091004 3300039447 Bacteria 1705
102 Ga0436361_0192381 3300039447 Bacteria 3197
103 Ga0436361_0728336 3300039447 Bacteria 1316
104 Ga0436361_0939313 3300039447 Bacteria 1816
105 Ga0436363_1016687 3300039450 Bacteria 917
106 Ga0436363_1196128 3300039450 Bacteria 4365
107 Ga0436363_1554709 3300039450 Bacteria 4055
108 Ga0436363_1575181 3300039450 Bacteria 3938
109 Ga0436362_0383442 3300039453 Bacteria 1373
110 Ga0436362_0386329 3300039453 Bacteria 1310
111 Ga0436362_0689008 3300039453 Bacteria 2940
112 Ga0466963_0068844 3300044694 Bacteria 2378
113 Ga0495580_0020941 3300046472 Bacteria 4830
114 Ga0495580_0028762 3300046472 Bacteria 4038
115 Ga0495580_0200810 3300046472 Bacteria 1374
116 Ga0495600_0110133 3300046809 Bacteria 1793
117 Ga0495604_0117802 3300047317 Bacteria 1926
118 Ga0495680_0353224 3300047322 Bacteria 1023
119 Ga0496104_0217141 3300048907 Bacteria 1824
120 Ga0496112_0095326 3300048915 Bacteria 2946
121 Ga0496120_0077375 3300048923 Bacteria 1811
122 Ga0501034_0007210 3300049571 Bacteria 11868
123 Ga0501034_0130271 3300049571 Bacteria 2499
124 Ga0501037_0006123 3300049573 Bacteria 8789
125 Ga0501041_0048608 3300049577 Bacteria 2584
126 Ga0501041_0196798 3300049577 Bacteria 1263
127 Ga0501042_0064678 3300049578 Bacteria 2614
128 Ga0501071_0450237 3300049587 Bacteria 985
129 Ga0501072_0223055 3300049588 Bacteria 1502
130 Ga0501074_0229441 3300049590 Bacteria 1322
131 Ga0501075_0004642 3300049591 Bacteria 9323
132 Ga0501075_0210048 3300049591 Bacteria 1485
133 Ga0501076_0045153 3300049592 Bacteria 3478
134 Ga0501076_0200071 3300049592 Bacteria 1631
135 Ga0501080_0419125 3300049742 Bacteria 1203
136 Ga0501081_0101297 3300049743 Bacteria 2036
137 Ga0501081_0246114 3300049743 Bacteria 1304
138 Ga0501044_0087602 3300049823 Bacteria 3145
139 Ga0501044_0559273 3300049823 Bacteria 1040
140 Ga0501045_0268059 3300049824 Bacteria 1271
141 nmdc:mga0n895_299377_c1 3300050512 Bacteria 1630
142 nmdc:mga0rr50_214848_c1 3300050513 Bacteria 1586
143 nmdc:mga08x19_80582_c1 3300050514 Bacteria 2137
144 Ga0495619_0030089 3300053085 Bacteria 3513
145 Ga0495619_0044021 3300053085 Bacteria 2928
146 Ga0500616_0048729 3300053153 Bacteria 2245
147 Ga0501084_0216927 3300054114 Bacteria 1614
148 Ga0530510_0079307 3300061734 Bacteria 2388
149 2842778056 2842775625 Bacteria 5587290
150 8057162508 8057160832 Bacteria 3268302
151 Ga0070698_100143425
152 Ga0070683_100024416
153 Ga0070680_100069604
154 Ga0070661_100011614
155 Ga0070659_100013599
156 Ga0070709_10010376
157 Ga0070714_100051881
158 Ga0070714_100053857
159 Ga0070714_100933816
160 Ga0070713_100023962
161 Ga0070713_100169109
162 Ga0070710_10356348
163 Ga0070711_100003711
164 Ga0070711_100134026
165 Ga0070681_10001611
166 Ga0070681_10055274
167 Ga0070706_100017732
168 Ga0070706_100039720
169 Ga0070707_100026835
170 Ga0070679_100029559
171 Ga0070684_100036002
172 Ga0070697_100028769
173 Ga0070686_100184399
174 Ga0070664_100008453
175 Ga0068854_100434444
176 Ga0068856_100129755
177 Ga0068851_10003424
178 Ga0081540_1018291
179 Ga0070717_10001680
180 Ga0070717_10085247
181 Ga0070712_100013961
182 Ga0070712_100020802
183 Ga0070712_100046247
184 Ga0070712_100158078
185 Ga0070712_100180416
186 Ga0075436_100020424
187 Ga0075435_100142193
188 Ga0114129_10071142
189 Ga0099796_10001667
190 Ga0182008_10044432
191 Ga0182008_10166145
192 Ga0213873_10028075
193 Ga0213872_10074049
194 Ga0213872_10147842
195 Ga0213874_10023815
196 Ga0213876_10162251
197 Ga0213875_10000091
198 Ga0213875_10002063
199 Ga0213875_10004285
200 Ga0213871_10003069
201 Ga0207699_10364791
202 Ga0207684_10010973
203 Ga0207707_10042548
204 Ga0207693_10005024
205 Ga0207693_10010152
206 Ga0207663_10054917
207 Ga0207660_10045151
208 Ga0207652_10061195
209 Ga0207646_10002543
210 Ga0207700_10013763
211 Ga0207700_10042627
212 Ga0207664_10060381
213 Ga0207664_10308176
214 Ga0207665_10130614
215 Ga0207665_10300497
216 Ga0316576_10000612
217 Ga0316576_10018216
218 Ga0316576_10187648
219 Ga0307416_100229528
220 Ga0316580_10020789
221 Ga0373926_0062448
222 Ga0373944_0010401
223 Ga0373923_0014185
224 Ga0373953_0001225
225 Ga0373954_0016607
226 Ga0373946_0059760
227 Ga0373955_0190328
228 Ga0316574_0098036
229 Ga0373935_0081398
230 Ga0373927_0042151
231 Ga0373933_0029248
232 Ga0373947_0024420
233 Ga0373947_0073170
234 Ga0373937_0027926
235 Ga0373937_0045168
236 Ga0373937_0094853
237 Ga0316584_0178980
238 Ga0373925_0272217
239 Ga0373925_0335195
240 Ga0436364_0408678
241 Ga0436364_0512396
242 Ga0436364_0831545
243 Ga0436364_1094263
244 Ga0436364_1193191
245 Ga0436365_0203373
246 Ga0436365_0296555
247 Ga0436365_1368074
248 Ga0436365_1661793
249 Ga0436360_0609818
250 Ga0436360_1237108
251 Ga0436361_0091004
252 Ga0436361_0192381
253 Ga0436361_0728336
254 Ga0436361_0939313
255 Ga0436363_1016687
256 Ga0436363_1196128
257 Ga0436363_1554709
258 Ga0436363_1575181
259 Ga0436362_0383442
260 Ga0436362_0386329
261 Ga0436362_0689008
262 Ga0466963_0068844
263 Ga0495580_0020941
264 Ga0495580_0028762
265 Ga0495580_0200810
266 Ga0495600_0110133
267 Ga0495604_0117802
268 Ga0495680_0353224
269 Ga0496104_0217141
270 Ga0496112_0095326
271 Ga0496120_0077375
272 Ga0501034_0007210
273 Ga0501034_0130271
274 Ga0501037_0006123
275 Ga0501041_0048608
276 Ga0501041_0196798
277 Ga0501042_0064678
278 Ga0501071_0450237
279 Ga0501072_0223055
280 Ga0501074_0229441
281 Ga0501075_0004642
282 Ga0501075_0210048
283 Ga0501076_0045153
284 Ga0501076_0200071
285 Ga0501080_0419125
286 Ga0501081_0101297
287 Ga0501081_0246114
288 Ga0501044_0087602
289 Ga0501044_0559273
290 Ga0501045_0268059
291 nmdc:mga0n895_299377_c1
292 nmdc:mga0rr50_214848_c1
293 nmdc:mga08x19_80582_c1
294 Ga0495619_0030089
295 Ga0495619_0044021
296 Ga0500616_0048729
297 Ga0501084_0216927
298 Ga0530510_0079307
299 2842778056
300 8057162508

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

39

204

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.8411 17 238
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.785 17 234
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7421 14 212
1h7q-assembly1.cif.gz_A dtdp-manganese complex of spsa from bacillus subtilis 0.7397 15 136
2z86-assembly2.cif.gz_C crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-glcua and udp 0.7387 14 243
ID Description Score Start End Superfamily
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8566 19 241 3.90.550.10
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8459 17 247 3.90.550.10
af_P40350_49_327_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8425 17 241 3.90.550.10
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8356 19 241 3.90.550.10
af_P77293_1_188_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8348 17 198 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A4V1ZS11-F1-model_v4 Glycosyltransferase family 2 protein 0.9869 13 115 GO:0005886
GO:0099621
AF-A0A7C5FNM4-F1-model_v4 Glycosyltransferase 0.9809 17 122 GO:0005886
GO:0016757
AF-A0A7Y6CFG3-F1-model_v4 Glycosyltransferase 0.9771 16 114 GO:0005886
GO:0016757
AF-A0A1H4FSV8-F1-model_v4 Glycosyl transferase family 2 0.9655 17 118 GO:0005886
GO:0099621
AF-F7S7D9-F1-model_v4 Dolichyl-phosphate beta-D-mannosyltransferase 0.9619 15 122 GO:0004582
GO:0009247
GO:0016020

Map