F207545

General Info

Members Datasets Scaffolds Average Seq Length
150 95 151 283

Family's Representative Sequence

Representative Sequence 3300001990|JGI24737J22298_10000465|JGI24737J22298_1000046516
Length 292
Sequence MASRQQIKQRIGSVKSTKQITKAMQLVAASKLRRAQEAAVGPRAYAEMARAILARLRNIAGGESEFRLFADRPVKNRLLIIVTGDRGLAGAYNSNVIRRMIQELRADRDKQIGTSLIVIGKQAAHAAGRIANVDVRGAYQDLPDKPDADTLRPILTTAVGLFADGDVDAVDIVYTKFISTVVQEMQVKRLLPAGLDPLETNNEKQEDQDVTVEPSAEAVLRLATLRLLDAQIYQALLEAAASEHSMRMLAMKNATDNASDIVDDLTLEYNNARQAAITQELAEISGGVEAMK

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
22 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
30 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
31 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
47 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
48 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
49 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
50 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
51 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
52 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
53 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
54 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
55 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
56 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
57 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
58 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
59 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
60 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
61 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
62 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
63 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
64 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
65 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
66 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
67 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
68 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
69 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
70 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
74 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
75 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
76 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
77 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
78 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
79 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
80 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
81 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
82 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
83 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
84 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
85 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
86 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
87 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
88 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
89 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
90 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
91 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
92 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
93 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
94 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
95 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 38
Nodule 0
Rhizoplane 0
Rhizosphere 59.33
Stem 0
Stem Tuber 0
Unclassified 2.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_3171956 2162886012 Bacteria 1613
2 MBSR1b_contig_3965285 2162886012 Bacteria 1613
3 JGI24740J21852_10027787 3300001979 Bacteria 1878
4 JGI24737J22298_10000465 3300001990 Bacteria 13962
5 JGI24735J21928_10000361 3300002067 Bacteria 15792
6 rootH1_10002360 3300003316 Bacteria 56099
7 rootH1_10002360 3300003323 Bacteria 3372
8 rootH1_10000983 3300003323 Bacteria 67573
9 Ga0070658_10002324 3300005327 Bacteria 15962
10 Ga0070670_100071493 3300005331 Bacteria 2979
11 Ga0070680_100385639 3300005336 Bacteria 1193
12 Ga0070660_100000111 3300005339 Bacteria 50807
13 Ga0070679_100001852 3300005530 Bacteria 19019
14 Ga0068855_100000002 3300005563 Bacteria 616881
15 Ga0068855_100000003 3300005563 Bacteria 589862
16 Ga0068855_100000050 3300005563 Bacteria 143762
17 Ga0068857_100161192 3300005577 Bacteria 2035
18 Ga0068854_100058952 3300005578 Bacteria 2773
19 Ga0068852_100000001 3300005616 Bacteria 716526
20 Ga0068852_100345779 3300005616 Bacteria 1451
21 Ga0075365_10000006 3300006038 Bacteria 123233
22 Ga0075365_10000026 3300006038 Bacteria 61245
23 Ga0075365_10000050 3300006038 Bacteria 37327
24 Ga0075365_10015533 3300006038 Bacteria 4608
25 Ga0075365_10021901 3300006038 Bacteria 3995
26 Ga0075365_10042844 3300006038 Bacteria 2961
27 Ga0075365_10108020 3300006038 Bacteria 1911
28 Ga0075365_10126763 3300006038 Bacteria 1764
29 Ga0075363_100003743 3300006048 Bacteria 6546
30 Ga0075364_10003689 3300006051 Bacteria 8741
31 Ga0075364_10049774 3300006051 Bacteria 2734
32 Ga0075362_10025461 3300006177 Bacteria 2519
33 Ga0075367_10000834 3300006178 Bacteria 12225
34 Ga0075369_10011359 3300006186 Bacteria 3503
35 Ga0075366_10056125 3300006195 Bacteria 2339
36 Ga0075370_10014193 3300006353 Bacteria 4245
37 Ga0075370_10020742 3300006353 Bacteria 3595
38 Ga0075370_10028302 3300006353 Bacteria 3114
39 Ga0075370_10030116 3300006353 Bacteria 3027
40 Ga0105240_10000004 3300009093 Bacteria 708156
41 Ga0105240_10001718 3300009093 Bacteria 36965
42 Ga0105240_10002482 3300009093 Bacteria 29634
43 Ga0105240_10381311 3300009093 Bacteria 1592
44 Ga0105241_10000007 3300009174 Bacteria 343524
45 Ga0105241_10003610 3300009174 Bacteria 11505
46 Ga0105248_10609230 3300009177 Bacteria 1232
47 Ga0105237_10000001 3300009545 Bacteria 1009213
48 Ga0105237_10000002 3300009545 Bacteria 702357
49 Ga0105237_10248796 3300009545 Bacteria 1779
50 Ga0105238_10007651 3300009551 Bacteria 10814
51 Ga0105238_10240640 3300009551 Bacteria 1787
52 Ga0105032_102022 3300009979 Bacteria 1833
53 Ga0105032_104324 3300009979 Unclassified 1216
54 Ga0105029_100144 3300009984 Bacteria 3604
55 Ga0105028_100051 3300009993 Bacteria 12526
56 Ga0157371_10043933 3300013102 Bacteria 3182
57 Ga0157371_10138194 3300013102 Bacteria 1736
58 Ga0157370_10001979 3300013104 Bacteria 25174
59 Ga0157369_10000024 3300013105 Bacteria 225851
60 Ga0157369_10000072 3300013105 Bacteria 140097
61 Ga0157369_10000376 3300013105 Bacteria 59223
62 Ga0157369_10073479 3300013105 Bacteria 3669
63 Ga0157369_10101752 3300013105 Bacteria 3062
64 Ga0157374_10231448 3300013296 Bacteria 1815
65 Ga0157372_10000002 3300013307 Bacteria 687862
66 Ga0157372_10000008 3300013307 Bacteria 305449
67 Ga0207705_10074588 3300025909 Bacteria 2463
68 Ga0207654_10000002 3300025911 Bacteria 1460142
69 Ga0207654_10010047 3300025911 Bacteria 4813
70 Ga0207695_10000009 3300025913 Bacteria 1034276
71 Ga0207695_10020071 3300025913 Bacteria 7667
72 Ga0207671_10000003 3300025914 Bacteria 1065461
73 Ga0207671_10000008 3300025914 Bacteria 798229
74 Ga0207657_10001111 3300025919 Bacteria 28575
75 Ga0207667_10000005 3300025949 Bacteria 715503
76 Ga0207667_10000008 3300025949 Bacteria 625138
77 Ga0207667_10000096 3300025949 Bacteria 143776
78 Ga0207667_10017225 3300025949 Bacteria 8141
79 Ga0207640_10033002 3300025981 Bacteria 3216
80 Ga0207674_10176969 3300026116 Bacteria 2086
81 Ga0207698_10000001 3300026142 Bacteria 625389
82 Ga0209813_10000344 3300027866 Bacteria 11966
83 Ga0316179_1029172 3300030734 Bacteria 15625
84 Ga0316180_1150523 3300030736 Bacteria 2947
85 Ga0316183_1126757 3300030742 Bacteria 10350
86 Ga0316181_1268062 3300030744 Unclassified 986
87 Ga0316182_1064120 3300030745 Bacteria 5133
88 Ga0316182_1071417 3300030745 Bacteria 26020
89 Ga0307509_10038935 3300031507 Bacteria 5182
90 Ga0307406_10000002 3300031901 Bacteria 255753
91 Ga0307406_10000102 3300031901 Bacteria 49288
92 Ga0439461_0000311 3300041410 Bacteria 6862
93 Ga0439461_0031172 3300041410 Bacteria 1112
94 Ga0439466_0038094 3300041411 Bacteria 1616
95 Ga0439445_0000256 3300042004 Bacteria 10142
96 Ga0439432_042170 3300042006 Bacteria 1442
97 Ga0439446_0000001 3300042156 Bacteria 275840
98 Ga0439434_0015263 3300042435 Bacteria 2289
99 Ga0466972_0035649 3300044658 Bacteria 2435
100 Ga0466970_0215723 3300044765 Bacteria 1070
101 Ga0495638_0000682 3300046460 Bacteria 36908
102 Ga0495634_0118729 3300046642 Bacteria 1695
103 Ga0495658_0021413 3300046683 Bacteria 3408
104 Ga0495671_0115401 3300046692 Bacteria 1311
105 Ga0495660_0000175 3300046810 Bacteria 69454
106 Ga0495672_0051149 3300047320 Bacteria 2435
107 Ga0495686_0007152 3300047472 Bacteria 8404
108 Ga0496125_0324924 3300048928 Unclassified 931
109 Ga0501032_0279150 3300049569 Bacteria 1082
110 Ga0501034_0000090 3300049571 Bacteria 165117
111 Ga0501034_0009689 3300049571 Bacteria 10077
112 Ga0501034_0315748 3300049571 Bacteria 1496
113 Ga0501037_0000001 3300049573 Bacteria 753276
114 Ga0501038_0026184 3300049574 Bacteria 5196
115 nmdc:mga00v17_101_c1 3300050491 Bacteria 50798
116 nmdc:mga00v17_11615_c1 3300050491 Bacteria 4842
117 nmdc:mga00v17_216451_c1 3300050491 Bacteria 1240
118 nmdc:mga0yw44_15_c1 3300050492 Bacteria 28425
119 nmdc:mga0yw44_19787_c1 3300050492 Bacteria 3720
120 nmdc:mga0yw44_1_c1 3300050492 Bacteria 702221
121 nmdc:mga0yw44_22147_c1 3300050492 Bacteria 3557
122 nmdc:mga0yw44_2699_c1 3300050492 Bacteria 7654
123 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
124 nmdc:mga0yw44_6_c1 3300050492 Bacteria 272478
125 nmdc:mga0yw44_87659_c1 3300050492 Bacteria 1962
126 nmdc:mga0k408_51422_c1 3300050493 Bacteria 2387
127 nmdc:mga06z11_284_c1 3300050494 Bacteria 19699
128 nmdc:mga04h51_1490_c1 3300050495 Bacteria 5418
129 nmdc:mga07m45_10963_c1 3300050496 Bacteria 4750
130 nmdc:mga07m45_23556_c1 3300050496 Bacteria 2709
131 nmdc:mga07m45_672_c1 3300050496 Bacteria 9274
132 nmdc:mga0sz30_2707_c2 3300050516 Bacteria 5715
133 Ga0500643_000010 3300053087 Bacteria 408084
134 Ga0500643_002766 3300053087 Bacteria 8779
135 Ga0500643_007525 3300053087 Bacteria 4376
136 Ga0500646_0000001 3300053090 Bacteria 273936
137 Ga0500583_0000572 3300053092 Bacteria 11157
138 Ga0500583_0003890 3300053092 Bacteria 4784
139 Ga0500651_0000001 3300053093 Bacteria 529808
140 Ga0500641_0000001 3300053096 Bacteria 1115973
141 Ga0500555_000005 3300053103 Bacteria 342334
142 Ga0500569_000025 3300053109 Bacteria 36908
143 Ga0500594_0000004 3300053118 Bacteria 174508
144 Ga0500652_000007 3300053131 Bacteria 165913
145 Ga0500655_000321 3300053133 Bacteria 10695
146 Ga0500568_0049565 3300053139 Bacteria 1657
147 Ga0500588_0000020 3300053146 Bacteria 40592
148 Ga0500616_0000012 3300053153 Bacteria 681798
149 Ga0500616_0004718 3300053153 Bacteria 9595
150 Ga0500620_001831 3300053155 Bacteria 4073
151 Ga0500570_052568 3300053724 Bacteria 2036

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006038 Ga0075365_10042844 Ga0075365_100428442 239
2 3300050491 nmdc:mga00v17_216451_c1 nmdc:mga00v17_216451_c1_109_972 239
3 3300050492 nmdc:mga0yw44_19787_c1 nmdc:mga0yw44_19787_c1_2727_3590 239
4 3300048928 Ga0496125_0324924 Ga0496125_0324924_85_885 241
5 3300006353 Ga0075370_10030116 Ga0075370_100301163 242
6 3300005331 Ga0070670_100071493 Ga0070670_1000714932 246
7 3300005577 Ga0068857_100161192 Ga0068857_1001611922 246
8 3300026116 Ga0207674_10176969 Ga0207674_101769692 246
9 3300006178 Ga0075367_10000834 Ga0075367_1000083410 247
10 3300009093 Ga0105240_10001718 Ga0105240_1000171815 247
11 3300013105 Ga0157369_10000376 Ga0157369_1000037662 247
12 3300025913 Ga0207695_10000009 Ga0207695_10000009951 247
13 3300025914 Ga0207671_10000003 Ga0207671_100000031007 247
14 3300025919 Ga0207657_10001111 Ga0207657_1000111124 247
15 3300049571 Ga0501034_0009689 Ga0501034_0009689_9067_9867 247
16 3300049569 Ga0501032_0279150 Ga0501032_0279150_218_1048 257
17 3300044658 Ga0466972_0035649 Ga0466972_0035649_1020_1889 261
18 3300013102 Ga0157371_10043933 Ga0157371_100439332 262
19 3300041410 Ga0439461_0031172 Ga0439461_0031172_59_928 263
20 3300041411 Ga0439466_0038094 Ga0439466_0038094_685_1554 263
21 3300042435 Ga0439434_0015263 Ga0439434_0015263_174_1043 263
22 3300053133 Ga0500655_000321 Ga0500655_000321_5554_6423 263
23 3300006038 Ga0075365_10000026 Ga0075365_1000002652 264
24 3300030734 Ga0316179_1029172 Ga0316179_102917217 264
25 3300030736 Ga0316180_1150523 Ga0316180_11505233 264
26 3300030742 Ga0316183_1126757 Ga0316183_11267576 264
27 3300030744 Ga0316181_1268062 Ga0316181_12680621 264
28 3300030745 Ga0316182_1071417 Ga0316182_107141723 264
29 3300042004 Ga0439445_0000256 Ga0439445_0000256_6436_7308 264
30 3300042006 Ga0439432_042170 Ga0439432_042170_365_1237 264
31 3300050492 nmdc:mga0yw44_15_c1 nmdc:mga0yw44_15_c1_14545_15414 264
32 3300053087 Ga0500643_007525 Ga0500643_007525_854_1720 264
33 3300053093 Ga0500651_0000001 Ga0500651_0000001_53447_54313 264
34 3300053118 Ga0500594_0000004 Ga0500594_0000004_159158_160024 264
35 3300050496 nmdc:mga07m45_10963_c1 nmdc:mga07m45_10963_c1_2354_3223 265
36 3300053153 Ga0500616_0000012 Ga0500616_0000012_671758_672627 265
37 3300006038 Ga0075365_10021901 Ga0075365_100219013 266
38 3300006353 Ga0075370_10020742 Ga0075370_100207423 266
39 3300009979 Ga0105032_104324 Ga0105032_1043241 266
40 3300046692 Ga0495671_0115401 Ga0495671_0115401_47_916 266
41 3300046810 Ga0495660_0000175 Ga0495660_0000175_55222_56091 266
42 3300050492 nmdc:mga0yw44_2699_c1 nmdc:mga0yw44_2699_c1_5336_6205 266
43 3300050496 nmdc:mga07m45_23556_c1 nmdc:mga07m45_23556_c1_1010_1879 266
44 3300053090 Ga0500646_0000001 Ga0500646_0000001_14286_15155 266
45 3300053092 Ga0500583_0000572 Ga0500583_0000572_5571_6440 266
46 3300053096 Ga0500641_0000001 Ga0500641_0000001_376116_376985 266
47 3300053131 Ga0500652_000007 Ga0500652_000007_151392_152261 266
48 3300053155 Ga0500620_001831 Ga0500620_001831_1136_2005 266
49 3300003316 rootH1_10002360 rootH1_1000236057 267
50 3300001979 JGI24740J21852_10027787 JGI24740J21852_100277872 268
51 3300005563 Ga0068855_100000002 Ga0068855_10000000249 268
52 3300009093 Ga0105240_10381311 Ga0105240_103813112 268
53 3300013105 Ga0157369_10101752 Ga0157369_101017522 268
54 3300025949 Ga0207667_10000005 Ga0207667_10000005161 268
55 3300044765 Ga0466970_0215723 Ga0466970_0215723_93_962 268
56 3300001990 JGI24737J22298_10000465 JGI24737J22298_1000046516 269
57 3300002067 JGI24735J21928_10000361 JGI24735J21928_100003617 269
58 3300005563 Ga0068855_100000003 Ga0068855_100000003394 269
59 3300005616 Ga0068852_100345779 Ga0068852_1003457791 269
60 3300006038 Ga0075365_10000050 Ga0075365_1000005026 269
61 3300006038 Ga0075365_10108020 Ga0075365_101080202 269
62 3300006051 Ga0075364_10049774 Ga0075364_100497742 269
63 3300006353 Ga0075370_10014193 Ga0075370_100141935 269
64 3300009174 Ga0105241_10000007 Ga0105241_10000007267 269
65 3300009177 Ga0105248_10609230 Ga0105248_106092301 269
66 3300009545 Ga0105237_10248796 Ga0105237_102487963 269
67 3300009979 Ga0105032_102022 Ga0105032_1020222 269
68 3300009993 Ga0105028_100051 Ga0105028_1000515 269
69 3300013105 Ga0157369_10000072 Ga0157369_1000007256 269
70 3300025911 Ga0207654_10000002 Ga0207654_100000021279 269
71 3300025949 Ga0207667_10000008 Ga0207667_10000008385 269
72 3300031901 Ga0307406_10000002 Ga0307406_10000002190 269
73 3300046683 Ga0495658_0021413 Ga0495658_0021413_1426_2295 269
74 3300047472 Ga0495686_0007152 Ga0495686_0007152_1028_1924 269
75 3300050491 nmdc:mga00v17_11615_c1 nmdc:mga00v17_11615_c1_2120_2995 269
76 3300050492 nmdc:mga0yw44_2_c1 nmdc:mga0yw44_2_c1_458838_459707 269
77 3300050492 nmdc:mga0yw44_87659_c1 nmdc:mga0yw44_87659_c1_503_1378 269
78 3300050496 nmdc:mga07m45_672_c1 nmdc:mga07m45_672_c1_2730_3599 269
79 3300053087 Ga0500643_000010 Ga0500643_000010_239814_240680 269
80 3300053139 Ga0500568_0049565 Ga0500568_0049565_713_1579 269
81 3300003323 rootH1_10000983 rootH1_1000098337 270
82 3300005327 Ga0070658_10002324 Ga0070658_100023246 270
83 3300005336 Ga0070680_100385639 Ga0070680_1003856392 270
84 3300005339 Ga0070660_100000111 Ga0070660_10000011148 270
85 3300005530 Ga0070679_100001852 Ga0070679_1000018522 270
86 3300005563 Ga0068855_100000050 Ga0068855_100000050161 270
87 3300005578 Ga0068854_100058952 Ga0068854_1000589522 270
88 3300005616 Ga0068852_100000001 Ga0068852_100000001717 270
89 3300006038 Ga0075365_10000006 Ga0075365_1000000635 270
90 3300006038 Ga0075365_10015533 Ga0075365_100155335 270
91 3300006038 Ga0075365_10126763 Ga0075365_101267632 270
92 3300006048 Ga0075363_100003743 Ga0075363_1000037433 270
93 3300006051 Ga0075364_10003689 Ga0075364_100036892 270
94 3300006177 Ga0075362_10025461 Ga0075362_100254612 270
95 3300006186 Ga0075369_10011359 Ga0075369_100113593 270
96 3300006195 Ga0075366_10056125 Ga0075366_100561252 270
97 3300006353 Ga0075370_10028302 Ga0075370_100283022 270
98 3300009093 Ga0105240_10000004 Ga0105240_10000004571 270
99 3300009093 Ga0105240_10002482 Ga0105240_100024826 270
100 3300009174 Ga0105241_10003610 Ga0105241_100036104 270
101 3300009545 Ga0105237_10000001 Ga0105237_100000011003 270
102 3300009545 Ga0105237_10000002 Ga0105237_10000002610 270
103 3300009551 Ga0105238_10007651 Ga0105238_100076515 270
104 3300009551 Ga0105238_10240640 Ga0105238_102406401 270
105 3300009984 Ga0105029_100144 Ga0105029_1001442 270
106 3300013102 Ga0157371_10138194 Ga0157371_101381941 270
107 3300013104 Ga0157370_10001979 Ga0157370_100019793 270
108 3300013105 Ga0157369_10000024 Ga0157369_10000024177 270
109 3300013105 Ga0157369_10073479 Ga0157369_100734792 270
110 3300013296 Ga0157374_10231448 Ga0157374_102314482 270
111 3300013307 Ga0157372_10000002 Ga0157372_10000002548 270
112 3300013307 Ga0157372_10000008 Ga0157372_10000008163 270
113 3300025909 Ga0207705_10074588 Ga0207705_100745883 270
114 3300025911 Ga0207654_10010047 Ga0207654_100100474 270
115 3300025913 Ga0207695_10020071 Ga0207695_100200716 270
116 3300025914 Ga0207671_10000008 Ga0207671_10000008716 270
117 3300025949 Ga0207667_10000096 Ga0207667_10000096159 270
118 3300025949 Ga0207667_10017225 Ga0207667_100172259 270
119 3300025981 Ga0207640_10033002 Ga0207640_100330022 270
120 3300026142 Ga0207698_10000001 Ga0207698_10000001668 270
121 3300027866 Ga0209813_10000344 Ga0209813_1000034410 270
122 3300030745 Ga0316182_1064120 Ga0316182_10641202 270
123 3300031507 Ga0307509_10038935 Ga0307509_100389351 270
124 3300041410 Ga0439461_0000311 Ga0439461_0000311_3708_4577 270
125 3300042156 Ga0439446_0000001 Ga0439446_0000001_270151_271020 270
126 3300046460 Ga0495638_0000682 Ga0495638_0000682_3055_3924 270
127 3300046642 Ga0495634_0118729 Ga0495634_0118729_220_1089 270
128 3300047320 Ga0495672_0051149 Ga0495672_0051149_547_1416 270
129 3300049571 Ga0501034_0000090 Ga0501034_0000090_20957_21826 270
130 3300049571 Ga0501034_0315748 Ga0501034_0315748_592_1461 270
131 3300049573 Ga0501037_0000001 Ga0501037_0000001_464117_464986 270
132 3300049574 Ga0501038_0026184 Ga0501038_0026184_2236_3105 270
133 3300050491 nmdc:mga00v17_101_c1 nmdc:mga00v17_101_c1_45447_46316 270
134 3300050492 nmdc:mga0yw44_1_c1 nmdc:mga0yw44_1_c1_609716_610585 270
135 3300050492 nmdc:mga0yw44_22147_c1 nmdc:mga0yw44_22147_c1_872_1741 270
136 3300050492 nmdc:mga0yw44_6_c1 nmdc:mga0yw44_6_c1_158638_159507 270
137 3300050493 nmdc:mga0k408_51422_c1 nmdc:mga0k408_51422_c1_1264_2133 270
138 3300050494 nmdc:mga06z11_284_c1 nmdc:mga06z11_284_c1_1326_2195 270
139 3300050495 nmdc:mga04h51_1490_c1 nmdc:mga04h51_1490_c1_825_1694 270
140 3300050516 nmdc:mga0sz30_2707_c2 nmdc:mga0sz30_2707_c2_1123_1992 270
141 3300053087 Ga0500643_002766 Ga0500643_002766_5122_5991 270
142 3300053092 Ga0500583_0003890 Ga0500583_0003890_1736_2605 270
143 3300053103 Ga0500555_000005 Ga0500555_000005_54543_55412 270
144 3300053109 Ga0500569_000025 Ga0500569_000025_3055_3924 270
145 3300053146 Ga0500588_0000020 Ga0500588_0000020_3027_3896 270
146 3300053153 Ga0500616_0004718 Ga0500616_0004718_2494_3363 270
147 3300053724 Ga0500570_052568 Ga0500570_052568_762_1631 270
148 2162886012 MBSR1b_contig_3171956 MBSR1b_0079.00008240 271
149 2162886012 MBSR1b_contig_3965285 MBSR1b_0404.00001090 271
150 3300031901 Ga0307406_10000102 Ga0307406_100001026 271

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00231

ATP-synt

ATP synthase

3

291

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fs0-assembly1.cif.gz_G complex of gamma/epsilon atp synthase from e.coli 0.8621 8 237
7nkn-assembly1.cif.gz_G mycobacterium smegmatis atp synthase rotor state 3 0.8492 8 242
7nkk-assembly1.cif.gz_G mycobacterium smegmatis atp synthase rotor state 2 0.8448 8 242
1fs0-assembly1.cif.gz_G complex of gamma/epsilon atp synthase from e.coli 0.8439 8 237
6tmj-assembly1.cif.gz_g2 cryo-em structure of toxoplasma gondii mitochondrial atp synthase dimer, rotor-stator model 0.8182 18 234
ID Description Score Start End Superfamily
af_I1KY89_89_218_3.40.1380.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.9352 58 177 3.40.1380.10
1fs0G01 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.9277 54 181 3.40.1380.10
2qe7G02 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.9193 53 180 3.40.1380.10
1fs0G01 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.9008 54 181 3.40.1380.10
af_A0A1D6QQB0_1_102_3.40.1380.10 Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;ATP synthase, F1 complex, gamma subunit 0.8966 64 160 3.40.1380.10
ID Description Score Start End GO Terms
AF-A0A7S3DHR3-F1-model_v4 F-ATPase gamma subunit 0.9469 53 177 GO:0045261
GO:0046933
AF-A0A0G1PHF4-F1-model_v4 ATP synthase gamma chain 0.9139 1 190 GO:0045261
GO:0046933
AF-A0A0G1PHF4-F1-model_v4 ATP synthase gamma chain 0.9092 1 190 GO:0045261
GO:0046933
AF-A0A7W2GEH4-F1-model_v4 deleted 0.9089 15 182
AF-A0A833KPE0-F1-model_v4 deleted 0.8842 57 237

Feature Viewer

pLDDT pTM Quality
80.6 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map