F207483

General Info

Members Datasets Scaffolds Average Seq Length
149 128 298 168

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8046767195|8046771180
Length 181
Sequence LEALAVTRPVAPLVLLVEKASWLVQMVAQPSFAQLVLRVGLAVPFWRSGILKWDGFLQLSDTAVELFTDEFMLHLPGGPYAYPAPAVMAFLSGSAEVVFSTLLVFGLATRFAAAGLLAMTGIVELTVPDGWPVHITWAAMALGIMAWGPGRLSLDYLARRVLGMDTPFRSPSPVTPAEDQA

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
31 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
41 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
43 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
68 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
69 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
70 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
73 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
74 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
75 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
76 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
77 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
78 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
79 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
80 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
81 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
82 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
83 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
84 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
85 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
86 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
87 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
88 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
89 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
90 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
96 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
99 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
100 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
101 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
102 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
105 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
106 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
107 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
108 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
109 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
110 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
111 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
112 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
113 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
114 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
115 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
116 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
117 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
118 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
119 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
120 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
121 2643221558 Rhizobium sp. Root149 Isolate Unclassified
122 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
123 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
124 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
125 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
126 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
127 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
128 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.93
Metatranscriptomes 0
Isolates 10.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.74
Nodule 6.04
Rhizoplane 6.71
Rhizosphere 61.07
Stem 0
Stem Tuber 0
Unclassified 2.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1003556 3300003214 Bacteria 3800
2 rootL2_10333845 3300003322 Bacteria 2306
3 Ga0055539_1003141 3300003752 Bacteria 2355
4 Ga0055526_1000707 3300003771 Bacteria 25281
5 Ga0055524_1008197 3300003775 Bacteria 4360
6 Ga0055528_1013537 3300003790 Bacteria 3083
7 Ga0070660_100702130 3300005339 Bacteria 848
8 Ga0070689_100723884 3300005340 Bacteria 870
9 Ga0070688_100670504 3300005365 Bacteria 800
10 Ga0070714_100359518 3300005435 Bacteria 1369
11 Ga0070713_100123050 3300005436 Bacteria 2277
12 Ga0070710_10004223 3300005437 Bacteria 6808
13 Ga0070711_100018183 3300005439 Bacteria 4484
14 Ga0070711_100443216 3300005439 Bacteria 1062
15 Ga0070698_100031109 3300005471 Bacteria 5533
16 Ga0070699_100954388 3300005518 Bacteria 786
17 Ga0068853_100032781 3300005539 Bacteria 4403
18 Ga0070664_100592922 3300005564 Bacteria 1027
19 Ga0068857_100053274 3300005577 Bacteria 3590
20 Ga0068857_100054372 3300005577 Bacteria 3552
21 Ga0068854_100023278 3300005578 Bacteria 4229
22 Ga0068856_100049632 3300005614 Bacteria 4136
23 Ga0068852_100034286 3300005616 Bacteria 4221
24 Ga0068859_100076918 3300005617 Bacteria 3378
25 Ga0068851_10008713 3300005834 Bacteria 4697
26 Ga0081538_10016822 3300005981 Bacteria 5584
27 Ga0081540_1026608 3300005983 Bacteria 3297
28 Ga0070717_10417930 3300006028 Bacteria 1206
29 Ga0070715_10019805 3300006163 Plasmid 2586
30 Ga0070716_100048612 3300006173 Bacteria 2399
31 Ga0097620_100076920 3300006931 Bacteria 3378
32 Ga0099794_10195551 3300007265 Bacteria 1035
33 Ga0099795_10049149 3300007788 Bacteria 1530
34 Ga0099795_10058365 3300007788 Bacteria 1425
35 Ga0099795_10115761 3300007788 Bacteria 1067
36 Ga0105240_10171251 3300009093 Bacteria 2571
37 Ga0105247_10042412 3300009101 Bacteria 2787
38 Ga0105241_10002269 3300009174 Bacteria 14448
39 Ga0105241_10547703 3300009174 Bacteria 1038
40 Ga0105237_10052822 3300009545 Bacteria 4077
41 Ga0105237_10111144 3300009545 Bacteria 2732
42 Ga0105238_10075801 3300009551 Bacteria 3355
43 Ga0105238_10123292 3300009551 Bacteria 2571
44 Ga0099796_10016764 3300010159 Bacteria 2170
45 Ga0099796_10049650 3300010159 Bacteria 1451
46 Ga0099796_10100000 3300010159 Bacteria 1090
47 Ga0099796_10133708 3300010159 Bacteria 964
48 Ga0105239_10153464 3300010375 Bacteria 2571
49 Ga0105239_10660893 3300010375 Bacteria 1194
50 Ga0163163_10065243 3300014325 Bacteria 3614
51 Ga0224572_1034437 3300024225 Bacteria 962
52 Ga0209677_100485 3300025253 Bacteria 22570
53 Ga0209233_1000405 3300025261 Bacteria 34803
54 Ga0209673_1016261 3300025273 Bacteria 2790
55 Ga0209564_1000260 3300025295 Bacteria 112444
56 Ga0209256_1018792 3300025299 Bacteria 2227
57 Ga0209257_1025759 3300025304 Bacteria 2000
58 Ga0207656_10052725 3300025321 Bacteria 1762
59 Ga0207685_10014666 3300025905 Bacteria 2459
60 Ga0207699_10054486 3300025906 Bacteria 2376
61 Ga0207654_10000362 3300025911 Bacteria 26747
62 Ga0207654_10174182 3300025911 Bacteria 1399
63 Ga0207695_10015065 3300025913 Bacteria 9121
64 Ga0207671_10034107 3300025914 Bacteria 3784
65 Ga0207693_10009667 3300025915 Bacteria 7852
66 Ga0207693_10023322 3300025915 Bacteria 4913
67 Ga0207663_10067259 3300025916 Bacteria 2297
68 Ga0207657_10909204 3300025919 Bacteria 678
69 Ga0207694_10003423 3300025924 Bacteria 12628
70 Ga0207694_10944079 3300025924 Bacteria 730
71 Ga0207670_10634266 3300025936 Bacteria 880
72 Ga0207665_10039354 3300025939 Bacteria 3152
73 Ga0207679_10784796 3300025945 Bacteria 868
74 Ga0207667_10125548 3300025949 Bacteria 2643
75 Ga0207640_10022308 3300025981 Bacteria 3787
76 Ga0207639_10729818 3300026041 Bacteria 920
77 Ga0207702_10002300 3300026078 Bacteria 18295
78 Ga0207674_10082697 3300026116 Bacteria 3211
79 Ga0207698_10122716 3300026142 Bacteria 2202
80 Ga0268265_11282782 3300028380 Bacteria 732
81 Ga0307516_10167316 3300031730 Bacteria 1942
82 Ga0307510_10409668 3300033180 Bacteria 798
83 Ga0373923_0015323 3300035111 Bacteria 2893
84 Ga0373931_0555851 3300035691 Bacteria 746
85 Ga0436365_1183680 3300039437 Bacteria 908
86 Ga0436360_0684922 3300039438 Bacteria 683
87 Ga0436360_1333368 3300039438 Bacteria 1270
88 Ga0436363_1344593 3300039450 Bacteria 1192
89 Ga0439465_0037646 3300041413 Bacteria 1556
90 Ga0451837_0768623 3300041494 Bacteria 3618
91 Ga0451839_0537598 3300041496 Bacteria 5903
92 Ga0451847_0253149 3300041503 Bacteria 1859
93 Ga0451849_0161907 3300041505 Bacteria 1203
94 Ga0451851_0916893 3300041507 Bacteria 1669
95 Ga0451843_1550113 3300041509 Bacteria 9089
96 Ga0495585_0115995 3300046492 Bacteria 1420
97 Ga0495606_0016925 3300046507 Bacteria 5535
98 Ga0495606_0157700 3300046507 Bacteria 1327
99 Ga0495643_0142625 3300046522 Bacteria 1193
100 Ga0495663_0089732 3300046525 Bacteria 1001
101 Ga0495633_0015749 3300046558 Bacteria 3918
102 Ga0495625_0029673 3300046660 Bacteria 4087
103 Ga0495589_0070187 3300046794 Unclassified 1713
104 Ga0495672_0257320 3300047320 Bacteria 844
105 Ga0495686_0050453 3300047472 Bacteria 2614
106 Ga0495686_0140741 3300047472 Bacteria 1424
107 Ga0496102_0380199 3300048905 Bacteria 1329
108 Ga0496102_0639306 3300048905 Bacteria 987
109 Ga0496104_0009152 3300048907 Bacteria 8806
110 Ga0496106_0024365 3300048909 Bacteria 4499
111 Ga0496109_0328204 3300048912 Bacteria 1444
112 Ga0496110_0014579 3300048913 Bacteria 6530
113 Ga0496112_0006351 3300048915 Bacteria 10372
114 Ga0496113_0019439 3300048916 Bacteria 4752
115 Ga0496114_0469152 3300048917 Bacteria 1114
116 Ga0496115_0698681 3300048918 Bacteria 797
117 Ga0496121_0014032 3300048924 Bacteria 8552
118 Ga0496121_0376549 3300048924 Bacteria 937
119 Ga0496124_0120035 3300048927 Bacteria 2102
120 Ga0496126_0119738 3300048929 Bacteria 2284
121 Ga0496126_0151576 3300048929 Bacteria 1987
122 Ga0496126_0177571 3300048929 Bacteria 1811
123 Ga0501039_1199767 3300049575 Bacteria 587
124 Ga0501046_0119756 3300049580 Bacteria 2004
125 Ga0501073_0151923 3300049589 Bacteria 1605
126 Ga0501080_0406960 3300049742 Bacteria 1224
127 Ga0501083_0301300 3300049744 Bacteria 1042
128 Ga0500572_218574 3300053111 Unclassified 623
129 Ga0500559_0339254 3300053136 Bacteria 704
130 Ga0500603_123960 3300053150 Unclassified 785
131 Ga0500622_0118493 3300053156 Bacteria 1286
132 Ga0500637_0035106 3300053178 Bacteria 2809
133 Ga0501084_0490060 3300054114 Bacteria 1039
134 Ga0501082_0572771 3300060353 Bacteria 988
135 8046771180 8046767195 Bacteria 7547379
136 2510898125 2510461076 Bacteria 8618824
137 2513658617 2513237096 Bacteria 8722461
138 2513920819 2513237145 Bacteria 8979722
139 2515645649 2515154114 Bacteria 7848616
140 2515661443 2515154116 Bacteria 7552979
141 2517405353 2517287029 Bacteria 6905599
142 2643813929 2643221558 Bacteria 5460675
143 2739348928 2738543031 Bacteria 5769731
144 2792619283 2791355091 Bacteria 6135441
145 2792627056 2791355092 Bacteria 6248105
146 2852394296 2852387548 Bacteria 8025568
147 2896388064 2896384573 Bacteria 7700774
148 2920826850 2920822456 Bacteria 6897201
149 2935964741 2935959822 Bacteria 7869783
150 JGI25165J46597_1003556
151 rootL2_10333845
152 Ga0055539_1003141
153 Ga0055526_1000707
154 Ga0055524_1008197
155 Ga0055528_1013537
156 Ga0070660_100702130
157 Ga0070689_100723884
158 Ga0070688_100670504
159 Ga0070714_100359518
160 Ga0070713_100123050
161 Ga0070710_10004223
162 Ga0070711_100018183
163 Ga0070711_100443216
164 Ga0070698_100031109
165 Ga0070699_100954388
166 Ga0068853_100032781
167 Ga0070664_100592922
168 Ga0068857_100053274
169 Ga0068857_100054372
170 Ga0068854_100023278
171 Ga0068856_100049632
172 Ga0068852_100034286
173 Ga0068859_100076918
174 Ga0068851_10008713
175 Ga0081538_10016822
176 Ga0081540_1026608
177 Ga0070717_10417930
178 Ga0070715_10019805
179 Ga0070716_100048612
180 Ga0097620_100076920
181 Ga0099794_10195551
182 Ga0099795_10049149
183 Ga0099795_10058365
184 Ga0099795_10115761
185 Ga0105240_10171251
186 Ga0105247_10042412
187 Ga0105241_10002269
188 Ga0105241_10547703
189 Ga0105237_10052822
190 Ga0105237_10111144
191 Ga0105238_10075801
192 Ga0105238_10123292
193 Ga0099796_10016764
194 Ga0099796_10049650
195 Ga0099796_10100000
196 Ga0099796_10133708
197 Ga0105239_10153464
198 Ga0105239_10660893
199 Ga0163163_10065243
200 Ga0224572_1034437
201 Ga0209677_100485
202 Ga0209233_1000405
203 Ga0209673_1016261
204 Ga0209564_1000260
205 Ga0209256_1018792
206 Ga0209257_1025759
207 Ga0207656_10052725
208 Ga0207685_10014666
209 Ga0207699_10054486
210 Ga0207654_10000362
211 Ga0207654_10174182
212 Ga0207695_10015065
213 Ga0207671_10034107
214 Ga0207693_10009667
215 Ga0207693_10023322
216 Ga0207663_10067259
217 Ga0207657_10909204
218 Ga0207694_10003423
219 Ga0207694_10944079
220 Ga0207670_10634266
221 Ga0207665_10039354
222 Ga0207679_10784796
223 Ga0207667_10125548
224 Ga0207640_10022308
225 Ga0207639_10729818
226 Ga0207702_10002300
227 Ga0207674_10082697
228 Ga0207698_10122716
229 Ga0268265_11282782
230 Ga0307516_10167316
231 Ga0307510_10409668
232 Ga0373923_0015323
233 Ga0373931_0555851
234 Ga0436365_1183680
235 Ga0436360_0684922
236 Ga0436360_1333368
237 Ga0436363_1344593
238 Ga0439465_0037646
239 Ga0451837_0768623
240 Ga0451839_0537598
241 Ga0451847_0253149
242 Ga0451849_0161907
243 Ga0451851_0916893
244 Ga0451843_1550113
245 Ga0495585_0115995
246 Ga0495606_0016925
247 Ga0495606_0157700
248 Ga0495643_0142625
249 Ga0495663_0089732
250 Ga0495633_0015749
251 Ga0495625_0029673
252 Ga0495589_0070187
253 Ga0495672_0257320
254 Ga0495686_0050453
255 Ga0495686_0140741
256 Ga0496102_0380199
257 Ga0496102_0639306
258 Ga0496104_0009152
259 Ga0496106_0024365
260 Ga0496109_0328204
261 Ga0496110_0014579
262 Ga0496112_0006351
263 Ga0496113_0019439
264 Ga0496114_0469152
265 Ga0496115_0698681
266 Ga0496121_0014032
267 Ga0496121_0376549
268 Ga0496124_0120035
269 Ga0496126_0119738
270 Ga0496126_0151576
271 Ga0496126_0177571
272 Ga0501039_1199767
273 Ga0501046_0119756
274 Ga0501073_0151923
275 Ga0501080_0406960
276 Ga0501083_0301300
277 Ga0500572_218574
278 Ga0500559_0339254
279 Ga0500603_123960
280 Ga0500622_0118493
281 Ga0500637_0035106
282 Ga0501084_0490060
283 Ga0501082_0572771
284 8046771180
285 2510898125
286 2513658617
287 2513920819
288 2515645649
289 2515661443
290 2517405353
291 2643813929
292 2739348928
293 2792619283
294 2792627056
295 2852394296
296 2896388064
297 2920826850
298 2935964741

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07681

DoxX

DoxX

33

129

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rld-assembly1.cif.gz_B crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.4752 38 145
2rld-assembly1.cif.gz_A crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.4591 38 145
2rld-assembly1.cif.gz_B crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.45 38 145
4gxe-assembly1.cif.gz_A t. vulcanus phycocyanin crystallized in 4m urea 0.4409 34 145
6y3d-assembly1.cif.gz_KKK x-ray structure of thermophilic c-phycocyanin from galdiera phlegrea 0.4388 34 145
ID Description Score Start End Superfamily
af_Q4E5C0_1_157_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6659 32 163 1.20.120.550
af_Q8NCS4_7_125_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6549 41 142 1.20.120.550
af_A4IAM6_1_156_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6213 34 163 1.20.120.550
af_D3ZYP5_7_123_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.611 41 140 1.20.120.550
af_Q8T0T9_12_131_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5931 41 145 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A1F8IQK5-F1-model_v4 deleted 0.9517 21 157
AF-A0A843YAV8-F1-model_v4 deleted 0.9471 34 158
AF-A0A4Y4ETM0-F1-model_v4 DoxX family protein 0.9464 35 160 GO:0005886
AF-A0A7W6WAG4-F1-model_v4 Putative oxidoreductase 0.9438 30 164 GO:0005886
AF-A0A7W1AWM3-F1-model_v4 DoxX family protein 0.9404 18 158 GO:0005886

Map