F205966

General Info

Members Datasets Scaffolds Average Seq Length
149 71 298 131

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_11552617|Ga0105239_115526172
Length 144
Sequence MVIFRRTPLARILVVEDDRDLNKAYSIILRHEGHEVVEAFDGKEALKKLKGFEPDLVLLDLLMPIMGGLEFLQQSELPKKHKNVKVLIFTNMENSPEVAAAYKLGAHRCIIKSWTAPHNLARVVNDTLHSKDKTAKDSATKAAA

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
28 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
33 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
48 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
49 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
50 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
51 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
52 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
53 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
54 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
55 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
56 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
57 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
58 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
65 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
66 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
67 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
68 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
69 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
70 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
71 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 0
Rhizoplane 0
Rhizosphere 97.99
Stem 0
Stem Tuber 0
Unclassified 22.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_11552617 3300010375 Unclassified 765
2 CNBas_1009447 3300000531 Unclassified 587
3 JGI24740J21852_10083692 3300001979 Bacteria 832
4 rootL2_10309580 3300003322 Unclassified 1299
5 rootH1_10127801 3300003323 Unclassified 1056
6 Ga0070658_10000118 3300005327 Bacteria 71171
7 Ga0070658_10000133 3300005327 Bacteria 65613
8 Ga0070658_10000783 3300005327 Bacteria 27328
9 Ga0070658_10005624 3300005327 Bacteria 10168
10 Ga0070658_10254449 3300005327 Bacteria 1490
11 Ga0070658_11090855 3300005327 Bacteria 694
12 Ga0070658_11947856 3300005327 Bacteria 507
13 Ga0070680_100008600 3300005336 Bacteria 7822
14 Ga0070680_100148504 3300005336 Bacteria 1967
15 Ga0070682_100001074 3300005337 Bacteria 15750
16 Ga0070660_100000035 3300005339 Bacteria 77932
17 Ga0070660_100000837 3300005339 Bacteria 20454
18 Ga0070660_100366320 3300005339 Bacteria 1188
19 Ga0070691_10020299 3300005341 Bacteria 3070
20 Ga0070692_10324957 3300005345 Unclassified 947
21 Ga0070659_100000384 3300005366 Bacteria 33511
22 Ga0070659_100526996 3300005366 Bacteria 1009
23 Ga0070663_100387682 3300005455 Bacteria 1139
24 Ga0070681_10012919 3300005458 Bacteria 8292
25 Ga0070679_100000389 3300005530 Bacteria 37362
26 Ga0070679_100000670 3300005530 Bacteria 29193
27 Ga0070679_100001147 3300005530 Bacteria 23192
28 Ga0070679_100190708 3300005530 Bacteria 2019
29 Ga0070679_100224267 3300005530 Bacteria 1840
30 Ga0070679_100681689 3300005530 Unclassified 970
31 Ga0070684_100148967 3300005535 Unclassified 2119
32 Ga0070684_100338848 3300005535 Bacteria 1382
33 Ga0070684_100418730 3300005535 Bacteria 1236
34 Ga0070684_100457917 3300005535 Bacteria 1179
35 Ga0068853_100083078 3300005539 Bacteria 2806
36 Ga0068855_100001079 3300005563 Bacteria 33901
37 Ga0068855_100012303 3300005563 Bacteria 10339
38 Ga0068855_100263258 3300005563 Unclassified 1920
39 Ga0068855_100957499 3300005563 Bacteria 901
40 Ga0068855_101154641 3300005563 Bacteria 807
41 Ga0068857_100000007 3300005577 Bacteria 152197
42 Ga0068857_100075107 3300005577 Bacteria 3013
43 Ga0068857_100131845 3300005577 Unclassified 2254
44 Ga0068856_100000001 3300005614 Bacteria 565602
45 Ga0068856_100071009 3300005614 Bacteria 3446
46 Ga0068856_100217614 3300005614 Bacteria 1925
47 Ga0081455_10000003 3300005937 Bacteria 367763
48 Ga0070717_10254642 3300006028 Bacteria 1552
49 Ga0105240_10139530 3300009093 Bacteria 2899
50 Ga0105240_10804374 3300009093 Unclassified 1018
51 Ga0105245_10000001 3300009098 Bacteria 939270
52 Ga0105245_10156827 3300009098 Bacteria 2157
53 Ga0105245_10355138 3300009098 Bacteria 1453
54 Ga0105245_13090210 3300009098 Unclassified 516
55 Ga0105248_11981296 3300009177 Bacteria 661
56 Ga0105238_10018751 3300009551 Bacteria 7047
57 Ga0105239_10387149 3300010375 Bacteria 1581
58 Ga0105246_10602430 3300011119 Unclassified 950
59 Ga0157373_10030219 3300013100 Bacteria 3898
60 Ga0157369_10085970 3300013105 Bacteria 3360
61 Ga0157369_11225736 3300013105 Bacteria 765
62 Ga0157369_11710600 3300013105 Bacteria 639
63 Ga0157374_10001234 3300013296 Bacteria 21840
64 Ga0157372_10007975 3300013307 Bacteria 11261
65 Ga0157372_10049853 3300013307 Bacteria 4657
66 Ga0157372_10223580 3300013307 Bacteria 2182
67 Ga0157376_11081337 3300014969 Bacteria 827
68 Ga0207705_10000011 3300025909 Bacteria 517768
69 Ga0207705_10000167 3300025909 Bacteria 71284
70 Ga0207705_10013427 3300025909 Bacteria 5909
71 Ga0207705_10052253 3300025909 Bacteria 2942
72 Ga0207705_10213298 3300025909 Bacteria 1465
73 Ga0207705_11515630 3300025909 Bacteria 507
74 Ga0207707_10147823 3300025912 Unclassified 2055
75 Ga0207707_11621332 3300025912 Unclassified 509
76 Ga0207695_10227989 3300025913 Bacteria 1768
77 Ga0207695_11045078 3300025913 Unclassified 696
78 Ga0207660_10024519 3300025917 Bacteria 4085
79 Ga0207660_10171109 3300025917 Unclassified 1681
80 Ga0207657_10002660 3300025919 Bacteria 19285
81 Ga0207657_10003103 3300025919 Bacteria 17765
82 Ga0207657_10010840 3300025919 Bacteria 9070
83 Ga0207652_10000657 3300025921 Bacteria 34000
84 Ga0207652_10001771 3300025921 Bacteria 18822
85 Ga0207652_10009252 3300025921 Bacteria 7925
86 Ga0207652_10137857 3300025921 Bacteria 2180
87 Ga0207652_10150468 3300025921 Unclassified 2084
88 Ga0207652_10254449 3300025921 Bacteria 1584
89 Ga0207652_10417259 3300025921 Unclassified 1211
90 Ga0207652_10795977 3300025921 Unclassified 840
91 Ga0207687_10000004 3300025927 Bacteria 841177
92 Ga0207687_10345033 3300025927 Bacteria 1211
93 Ga0207690_10010295 3300025932 Bacteria 5552
94 Ga0207711_11381472 3300025941 Bacteria 647
95 Ga0207667_10000268 3300025949 Bacteria 72064
96 Ga0207667_10158716 3300025949 Bacteria 2327
97 Ga0207667_10230027 3300025949 Unclassified 1899
98 Ga0207667_11654924 3300025949 Bacteria 608
99 Ga0207639_12061870 3300026041 Unclassified 531
100 Ga0207678_10702045 3300026067 Bacteria 890
101 Ga0207702_10000001 3300026078 Bacteria 895738
102 Ga0207702_10048578 3300026078 Bacteria 3579
103 Ga0207674_10000001 3300026116 Bacteria 616581
104 Ga0265327_10000017 3300031251 Bacteria 445264
105 Ga0265327_10012201 3300031251 Bacteria 5826
106 Ga0395899_0008284 3300037312 Bacteria 8005
107 Ga0395900_0002080 3300037418 Bacteria 22449
108 Ga0395900_0003532 3300037418 Bacteria 16817
109 Ga0395900_0013271 3300037418 Bacteria 8422
110 Ga0395900_0236579 3300037418 Bacteria 1834
111 Ga0395898_0010975 3300037466 Bacteria 9443
112 Ga0395905_0002031 3300037471 Bacteria 23129
113 Ga0395905_0177234 3300037471 Bacteria 2001
114 Ga0395905_0258781 3300037471 Unclassified 1625
115 Ga0395901_0004356 3300038443 Bacteria 14285
116 Ga0395901_0004364 3300038443 Bacteria 14268
117 Ga0395901_0266915 3300038443 Unclassified 1781
118 Ga0395901_0596675 3300038443 Unclassified 1114
119 Ga0466967_0558476 3300045976 Unclassified 1127
120 Ga0501031_0000276 3300049568 Bacteria 29045
121 Ga0501032_0006237 3300049569 Bacteria 8775
122 Ga0501032_0180217 3300049569 Unclassified 1383
123 Ga0501034_0009978 3300049571 Bacteria 9926
124 Ga0501034_0010039 3300049571 Bacteria 9887
125 Ga0501034_0500385 3300049571 Bacteria 1129
126 Ga0501036_0037305 3300049572 Bacteria 4112
127 Ga0501037_0000113 3300049573 Bacteria 75610
128 Ga0501037_0495946 3300049573 Unclassified 829
129 Ga0501038_0797874 3300049574 Unclassified 702
130 Ga0501039_0613601 3300049575 Unclassified 852
131 Ga0501043_0000205 3300049579 Bacteria 54247
132 Ga0501046_0000038 3300049580 Bacteria 159193
133 Ga0501047_0000355 3300049581 Bacteria 51922
134 Ga0501047_0046335 3300049581 Bacteria 4202
135 Ga0501070_0093128 3300049586 Bacteria 2493
136 Ga0501070_0647985 3300049586 Bacteria 839
137 Ga0501070_0923578 3300049586 Unclassified 680
138 Ga0501071_0863027 3300049587 Unclassified 698
139 Ga0501073_0055497 3300049589 Unclassified 2772
140 Ga0501083_0032828 3300049744 Unclassified 3557
141 Ga0501083_0044033 3300049744 Bacteria 3022
142 Ga0501083_0109003 3300049744 Bacteria 1821
143 Ga0501083_0254778 3300049744 Viruses 1142
144 Ga0501035_0000768 3300049822 Bacteria 34474
145 Ga0501035_0001368 3300049822 Bacteria 25088
146 Ga0501044_0161414 3300049823 Bacteria 2218
147 Ga0501044_0321074 3300049823 Bacteria 1473
148 Ga0500556_0001453 3300053104 Bacteria 10013
149 Ga0587094_012419 3300059513 Unclassified 1137
150 Ga0105239_11552617
151 CNBas_1009447
152 JGI24740J21852_10083692
153 rootL2_10309580
154 rootH1_10127801
155 Ga0070658_10000118
156 Ga0070658_10000133
157 Ga0070658_10000783
158 Ga0070658_10005624
159 Ga0070658_10254449
160 Ga0070658_11090855
161 Ga0070658_11947856
162 Ga0070680_100008600
163 Ga0070680_100148504
164 Ga0070682_100001074
165 Ga0070660_100000035
166 Ga0070660_100000837
167 Ga0070660_100366320
168 Ga0070691_10020299
169 Ga0070692_10324957
170 Ga0070659_100000384
171 Ga0070659_100526996
172 Ga0070663_100387682
173 Ga0070681_10012919
174 Ga0070679_100000389
175 Ga0070679_100000670
176 Ga0070679_100001147
177 Ga0070679_100190708
178 Ga0070679_100224267
179 Ga0070679_100681689
180 Ga0070684_100148967
181 Ga0070684_100338848
182 Ga0070684_100418730
183 Ga0070684_100457917
184 Ga0068853_100083078
185 Ga0068855_100001079
186 Ga0068855_100012303
187 Ga0068855_100263258
188 Ga0068855_100957499
189 Ga0068855_101154641
190 Ga0068857_100000007
191 Ga0068857_100075107
192 Ga0068857_100131845
193 Ga0068856_100000001
194 Ga0068856_100071009
195 Ga0068856_100217614
196 Ga0081455_10000003
197 Ga0070717_10254642
198 Ga0105240_10139530
199 Ga0105240_10804374
200 Ga0105245_10000001
201 Ga0105245_10156827
202 Ga0105245_10355138
203 Ga0105245_13090210
204 Ga0105248_11981296
205 Ga0105238_10018751
206 Ga0105239_10387149
207 Ga0105246_10602430
208 Ga0157373_10030219
209 Ga0157369_10085970
210 Ga0157369_11225736
211 Ga0157369_11710600
212 Ga0157374_10001234
213 Ga0157372_10007975
214 Ga0157372_10049853
215 Ga0157372_10223580
216 Ga0157376_11081337
217 Ga0207705_10000011
218 Ga0207705_10000167
219 Ga0207705_10013427
220 Ga0207705_10052253
221 Ga0207705_10213298
222 Ga0207705_11515630
223 Ga0207707_10147823
224 Ga0207707_11621332
225 Ga0207695_10227989
226 Ga0207695_11045078
227 Ga0207660_10024519
228 Ga0207660_10171109
229 Ga0207657_10002660
230 Ga0207657_10003103
231 Ga0207657_10010840
232 Ga0207652_10000657
233 Ga0207652_10001771
234 Ga0207652_10009252
235 Ga0207652_10137857
236 Ga0207652_10150468
237 Ga0207652_10254449
238 Ga0207652_10417259
239 Ga0207652_10795977
240 Ga0207687_10000004
241 Ga0207687_10345033
242 Ga0207690_10010295
243 Ga0207711_11381472
244 Ga0207667_10000268
245 Ga0207667_10158716
246 Ga0207667_10230027
247 Ga0207667_11654924
248 Ga0207639_12061870
249 Ga0207678_10702045
250 Ga0207702_10000001
251 Ga0207702_10048578
252 Ga0207674_10000001
253 Ga0265327_10000017
254 Ga0265327_10012201
255 Ga0395899_0008284
256 Ga0395900_0002080
257 Ga0395900_0003532
258 Ga0395900_0013271
259 Ga0395900_0236579
260 Ga0395898_0010975
261 Ga0395905_0002031
262 Ga0395905_0177234
263 Ga0395905_0258781
264 Ga0395901_0004356
265 Ga0395901_0004364
266 Ga0395901_0266915
267 Ga0395901_0596675
268 Ga0466967_0558476
269 Ga0501031_0000276
270 Ga0501032_0006237
271 Ga0501032_0180217
272 Ga0501034_0009978
273 Ga0501034_0010039
274 Ga0501034_0500385
275 Ga0501036_0037305
276 Ga0501037_0000113
277 Ga0501037_0495946
278 Ga0501038_0797874
279 Ga0501039_0613601
280 Ga0501043_0000205
281 Ga0501046_0000038
282 Ga0501047_0000355
283 Ga0501047_0046335
284 Ga0501070_0093128
285 Ga0501070_0647985
286 Ga0501070_0923578
287 Ga0501071_0863027
288 Ga0501073_0055497
289 Ga0501083_0032828
290 Ga0501083_0044033
291 Ga0501083_0109003
292 Ga0501083_0254778
293 Ga0501035_0000768
294 Ga0501035_0001368
295 Ga0501044_0161414
296 Ga0501044_0321074
297 Ga0500556_0001453
298 Ga0587094_012419

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

12

125

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3crn-assembly1.cif.gz_B crystal structure of response regulator receiver domain protein (chey-like) from methanospirillum hungatei jf-1 0.8934 1 122
2ftk-assembly2.cif.gz_H berylloflouride spo0f complex with spo0b 0.8896 1 119
1srr-assembly1.cif.gz_A-2 crystal structure of a phosphatase resistant mutant of sporulation response regulator spo0f from bacillus subtilis 0.8811 1 121
1nat-assembly1.cif.gz_A crystal structure of spoof from bacillus subtilis 0.881 1 121
3q15-assembly2.cif.gz_D-3 crystal structure of raph complexed with spo0f 0.881 3 118
ID Description Score Start End Superfamily
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9164 3 82 3.40.50.2300
2oqrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.908 1 80 3.40.50.2300
af_P71814_19_100_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9047 2 80 3.40.50.2300
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8993 3 82 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8975 1 80 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2M7TZ99-F1-model_v4 Response regulatory domain-containing protein 0.9496 1 130 GO:0000160
AF-A0A7W1KIK0-F1-model_v4 Response regulator 0.9463 1 123 GO:0000160
AF-A0A7W1KGH2-F1-model_v4 Response regulator 0.944 1 125 GO:0000160
AF-A0A2N5KC88-F1-model_v4 Response regulatory domain-containing protein 0.9433 1 119 GO:0000160
AF-A0A2M7TZ99-F1-model_v4 Response regulatory domain-containing protein 0.9426 1 130 GO:0000160

Map