F204304

General Info

Members Datasets Scaffolds Average Seq Length
148 83 296 277

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0045290|Ga0496126_0045290_446_1372
Length 308
Sequence MVKGIWQLDADQAARGLYFVRGFQCDAEAAVAYKTILVHCDAGKLVTSRLDVAVGLTQRFDAHLVALHARPPFQPPAFVESGMDLLLDDYEENVKIGQTAAAAAFTKAIEGKEIASEWRAVDGSADSMLIAHALYADLVIVGQNDPDATTVLPAPSDLPETVALSTGRAVLVVPHIGVQKTPGGTVLLCWNASREAARDASEALPLLKAAKQVIVLIVGPQTAADASSVEPGANVTAWLSRHGVKVTVQRDTSADADAGSAILSHAADHDADLIVMGIYGHSRLREMVLGGASRTLLSSMTVPVLMAN

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
35 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
36 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
52 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
53 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
54 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
55 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
56 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
57 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
58 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
61 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
62 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
63 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
64 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
65 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
66 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
67 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
69 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
70 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
71 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
72 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
73 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
74 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
75 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
76 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
77 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
78 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
79 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
80 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
81 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
82 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
83 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.78
Nodule 0
Rhizoplane 0
Rhizosphere 62.16
Stem 0
Stem Tuber 0
Unclassified 7.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0045290 3300048929 Bacteria 4045
2 Ga0070661_100117096 3300005344 Bacteria 1993
3 Ga0070661_100131782 3300005344 Unclassified 1878
4 Ga0070709_10205181 3300005434 Bacteria 1398
5 Ga0070709_10417463 3300005434 Bacteria 1005
6 Ga0070713_100040275 3300005436 Bacteria 3798
7 Ga0070708_100117279 3300005445 Bacteria 2452
8 Ga0070706_100031549 3300005467 Bacteria 4885
9 Ga0070707_100163218 3300005468 Bacteria 2171
10 Ga0070698_100000305 3300005471 Bacteria 50136
11 Ga0070699_100079846 3300005518 Bacteria 2851
12 Ga0070684_100044991 3300005535 Bacteria 3821
13 Ga0070684_100053200 3300005535 Bacteria 3523
14 Ga0070684_100076599 3300005535 Bacteria 2952
15 Ga0070665_100247045 3300005548 Bacteria 1785
16 Ga0070665_100624090 3300005548 Bacteria 1091
17 Ga0068855_100157024 3300005563 Bacteria 2584
18 Ga0068855_100554613 3300005563 Bacteria 1243
19 Ga0068855_100685739 3300005563 Unclassified 1097
20 Ga0070664_100005790 3300005564 Bacteria 9972
21 Ga0070664_100017644 3300005564 Bacteria 5861
22 Ga0070664_100048775 3300005564 Bacteria 3579
23 Ga0068857_100059525 3300005577 Bacteria 3393
24 Ga0068856_100012607 3300005614 Bacteria 8184
25 Ga0068856_100017872 3300005614 Bacteria 6878
26 Ga0068856_100033730 3300005614 Bacteria 5013
27 Ga0068852_100232258 3300005616 Bacteria 1759
28 Ga0068863_100335639 3300005841 Bacteria 1470
29 Ga0081455_10008781 3300005937 Bacteria 10458
30 Ga0081455_10121291 3300005937 Bacteria 2059
31 Ga0081455_10126713 3300005937 Bacteria 2003
32 Ga0075365_10024535 3300006038 Bacteria 3806
33 Ga0075368_10110787 3300006042 Bacteria 1132
34 Ga0075363_100015912 3300006048 Bacteria 3706
35 Ga0075364_10124667 3300006051 Archaea 1726
36 Ga0070716_100289069 3300006173 Bacteria 1135
37 Ga0070712_100208083 3300006175 Bacteria 1541
38 Ga0075362_10005170 3300006177 Bacteria 4755
39 Ga0075362_10008096 3300006177 Unclassified 4008
40 Ga0075362_10023209 3300006177 Archaea 2622
41 Ga0075367_10000807 3300006178 Bacteria 12368
42 Ga0075367_10015165 3300006178 Bacteria 4182
43 Ga0075367_10017950 3300006178 Bacteria 3894
44 Ga0075367_10117458 3300006178 Bacteria 1637
45 Ga0075369_10000595 3300006186 Bacteria 11457
46 Ga0075369_10000670 3300006186 Bacteria 10915
47 Ga0075369_10007762 3300006186 Bacteria 4103
48 Ga0075366_10009608 3300006195 Bacteria 5404
49 Ga0075366_10112251 3300006195 Bacteria 1640
50 Ga0075366_10115404 3300006195 Archaea 1617
51 Ga0075370_10130911 3300006353 Bacteria 1464
52 Ga0105241_10325840 3300009174 Archaea 1326
53 Ga0105239_10090088 3300010375 Bacteria 3384
54 Ga0105239_10262279 3300010375 Bacteria 1942
55 Ga0105239_10657939 3300010375 Bacteria 1197
56 Ga0157369_10059189 3300013105 Bacteria 4131
57 Ga0157369_10093885 3300013105 Bacteria 3203
58 Ga0157369_10110003 3300013105 Bacteria 2929
59 Ga0157369_10125951 3300013105 Bacteria 2716
60 Ga0157372_10023022 3300013307 Bacteria 6751
61 Ga0157372_10141097 3300013307 Bacteria 2776
62 Ga0213876_10016251 3300021384 Bacteria 3934
63 Ga0207426_1009741 3300025302 Bacteria 3777
64 Ga0207426_1019888 3300025302 Bacteria 2341
65 Ga0207656_10094653 3300025321 Unclassified 1361
66 Ga0207671_10111205 3300025914 Bacteria 2084
67 Ga0207657_10140329 3300025919 Bacteria 1975
68 Ga0207649_10085904 3300025920 Bacteria 2049
69 Ga0207649_10122680 3300025920 Unclassified 1754
70 Ga0207649_10219956 3300025920 Archaea 1352
71 Ga0207700_10126370 3300025928 Bacteria 2081
72 Ga0207690_10054449 3300025932 Bacteria 2690
73 Ga0207661_10337731 3300025944 Bacteria 1357
74 Ga0207679_10062872 3300025945 Bacteria 2768
75 Ga0207667_10044896 3300025949 Bacteria 4681
76 Ga0207651_10270397 3300025960 Bacteria 1400
77 Ga0207639_10287013 3300026041 Archaea 1449
78 Ga0207702_10019294 3300026078 Bacteria 5642
79 Ga0207702_10133772 3300026078 Bacteria 2235
80 Ga0207674_10023749 3300026116 Bacteria 6562
81 Ga0207674_10042367 3300026116 Bacteria 4702
82 Ga0207674_10692795 3300026116 Unclassified 984
83 Ga0207698_10089112 3300026142 Bacteria 2518
84 Ga0268266_10099355 3300028379 Bacteria 2562
85 Ga0265334_10033529 3300028573 Bacteria 2043
86 Ga0265332_10045977 3300031238 Bacteria 1880
87 Ga0265340_10024172 3300031247 Bacteria 3088
88 Ga0373941_0111660 3300035115 Unclassified 964
89 Ga0373931_0048496 3300035691 Bacteria 2252
90 Ga0373947_0366255 3300035725 Bacteria 969
91 Ga0373925_0197255 3300037068 Bacteria 1600
92 Ga0395899_0087884 3300037312 Bacteria 2255
93 Ga0395899_0106737 3300037312 Bacteria 2016
94 Ga0395900_0005559 3300037418 Bacteria 13197
95 Ga0395900_0013455 3300037418 Bacteria 8359
96 Ga0395901_0001876 3300038443 Bacteria 21667
97 Ga0395901_0003060 3300038443 Bacteria 16850
98 Ga0395901_0009335 3300038443 Bacteria 9945
99 Ga0395901_0012738 3300038443 Bacteria 8531
100 Ga0395901_0033494 3300038443 Bacteria 5304
101 Ga0395901_0089351 3300038443 Bacteria 3224
102 Ga0395901_0563391 3300038443 Bacteria 1153
103 Ga0436365_0565814 3300039437 Bacteria 1966
104 Ga0436365_1047418 3300039437 Bacteria 1842
105 Ga0436365_1622533 3300039437 Bacteria 43532
106 Ga0436360_0413154 3300039438 Bacteria 24772
107 Ga0436360_1204557 3300039438 Bacteria 1413
108 Ga0436362_0453529 3300039453 Bacteria 1256
109 Ga0495623_0322632 3300046679 Unclassified 848
110 Ga0495602_0481426 3300048088 Unclassified 871
111 Ga0496126_0178653 3300048929 Unclassified 1804
112 Ga0501032_0308301 3300049569 Bacteria 1023
113 Ga0501034_0025681 3300049571 Bacteria 5999
114 Ga0501034_0082482 3300049571 Bacteria 3217
115 Ga0501034_0135448 3300049571 Bacteria 2444
116 Ga0501034_0174034 3300049571 Bacteria 2119
117 Ga0501070_0139644 3300049586 Bacteria 2001
118 Ga0501074_0123365 3300049590 Bacteria 1853
119 nmdc:mga03683_20752_c1 3300050489 Bacteria 2525
120 nmdc:mga03683_4589_c1 3300050489 Bacteria 4598
121 nmdc:mga03683_5402_c1 3300050489 Bacteria 4314
122 nmdc:mga03n38_22084_c1 3300050490 Bacteria 2570
123 nmdc:mga03n38_42210_c1 3300050490 Bacteria 1992
124 nmdc:mga00v17_116670_c1 3300050491 Archaea 1697
125 nmdc:mga00v17_303252_c1 3300050491 Bacteria 1037
126 nmdc:mga0yw44_125003_c1 3300050492 Bacteria 1660
127 nmdc:mga0yw44_16513_c1 3300050492 Bacteria 3989
128 nmdc:mga0yw44_213742_c1 3300050492 Bacteria 1276
129 nmdc:mga0yw44_223926_c1 3300050492 Bacteria 1247
130 nmdc:mga0k408_107540_c1 3300050493 Bacteria 1647
131 nmdc:mga0k408_155808_c1 3300050493 Bacteria 1360
132 nmdc:mga0k408_192232_c1 3300050493 Bacteria 1218
133 nmdc:mga06z11_10602_c1 3300050494 Bacteria 3935
134 nmdc:mga06z11_342554_c1 3300050494 Bacteria 894
135 nmdc:mga06z11_3503_c1 3300050494 Bacteria 6076
136 nmdc:mga06z11_47254_c1 3300050494 Bacteria 2185
137 nmdc:mga07m45_56554_c1 3300050496 Bacteria 2217
138 nmdc:mga07m45_6029_c1 3300050496 Bacteria 6099
139 nmdc:mga0sz30_18207_c1 3300050516 Bacteria 2809
140 nmdc:mga0sz30_20720_c1 3300050516 Bacteria 2654
141 nmdc:mga0sz30_394_c1 3300050516 Bacteria 16605
142 nmdc:mga0sz30_48392_c1 3300050516 Bacteria 1799
143 Ga0500647_0013219 3300053091 Bacteria 3732
144 Ga0500641_0000512 3300053096 Bacteria 13950
145 Ga0500568_0015594 3300053139 Bacteria 3399
146 Ga0500616_0000925 3300053153 Bacteria 32079
147 Ga0500620_121876 3300053155 Unclassified 914
148 Ga0500552_000257 3300053733 Bacteria 4861
149 Ga0496126_0045290
150 Ga0070661_100117096
151 Ga0070661_100131782
152 Ga0070709_10205181
153 Ga0070709_10417463
154 Ga0070713_100040275
155 Ga0070708_100117279
156 Ga0070706_100031549
157 Ga0070707_100163218
158 Ga0070698_100000305
159 Ga0070699_100079846
160 Ga0070684_100044991
161 Ga0070684_100053200
162 Ga0070684_100076599
163 Ga0070665_100247045
164 Ga0070665_100624090
165 Ga0068855_100157024
166 Ga0068855_100554613
167 Ga0068855_100685739
168 Ga0070664_100005790
169 Ga0070664_100017644
170 Ga0070664_100048775
171 Ga0068857_100059525
172 Ga0068856_100012607
173 Ga0068856_100017872
174 Ga0068856_100033730
175 Ga0068852_100232258
176 Ga0068863_100335639
177 Ga0081455_10008781
178 Ga0081455_10121291
179 Ga0081455_10126713
180 Ga0075365_10024535
181 Ga0075368_10110787
182 Ga0075363_100015912
183 Ga0075364_10124667
184 Ga0070716_100289069
185 Ga0070712_100208083
186 Ga0075362_10005170
187 Ga0075362_10008096
188 Ga0075362_10023209
189 Ga0075367_10000807
190 Ga0075367_10015165
191 Ga0075367_10017950
192 Ga0075367_10117458
193 Ga0075369_10000595
194 Ga0075369_10000670
195 Ga0075369_10007762
196 Ga0075366_10009608
197 Ga0075366_10112251
198 Ga0075366_10115404
199 Ga0075370_10130911
200 Ga0105241_10325840
201 Ga0105239_10090088
202 Ga0105239_10262279
203 Ga0105239_10657939
204 Ga0157369_10059189
205 Ga0157369_10093885
206 Ga0157369_10110003
207 Ga0157369_10125951
208 Ga0157372_10023022
209 Ga0157372_10141097
210 Ga0213876_10016251
211 Ga0207426_1009741
212 Ga0207426_1019888
213 Ga0207656_10094653
214 Ga0207671_10111205
215 Ga0207657_10140329
216 Ga0207649_10085904
217 Ga0207649_10122680
218 Ga0207649_10219956
219 Ga0207700_10126370
220 Ga0207690_10054449
221 Ga0207661_10337731
222 Ga0207679_10062872
223 Ga0207667_10044896
224 Ga0207651_10270397
225 Ga0207639_10287013
226 Ga0207702_10019294
227 Ga0207702_10133772
228 Ga0207674_10023749
229 Ga0207674_10042367
230 Ga0207674_10692795
231 Ga0207698_10089112
232 Ga0268266_10099355
233 Ga0265334_10033529
234 Ga0265332_10045977
235 Ga0265340_10024172
236 Ga0373941_0111660
237 Ga0373931_0048496
238 Ga0373947_0366255
239 Ga0373925_0197255
240 Ga0395899_0087884
241 Ga0395899_0106737
242 Ga0395900_0005559
243 Ga0395900_0013455
244 Ga0395901_0001876
245 Ga0395901_0003060
246 Ga0395901_0009335
247 Ga0395901_0012738
248 Ga0395901_0033494
249 Ga0395901_0089351
250 Ga0395901_0563391
251 Ga0436365_0565814
252 Ga0436365_1047418
253 Ga0436365_1622533
254 Ga0436360_0413154
255 Ga0436360_1204557
256 Ga0436362_0453529
257 Ga0495623_0322632
258 Ga0495602_0481426
259 Ga0496126_0178653
260 Ga0501032_0308301
261 Ga0501034_0025681
262 Ga0501034_0082482
263 Ga0501034_0135448
264 Ga0501034_0174034
265 Ga0501070_0139644
266 Ga0501074_0123365
267 nmdc:mga03683_20752_c1
268 nmdc:mga03683_4589_c1
269 nmdc:mga03683_5402_c1
270 nmdc:mga03n38_22084_c1
271 nmdc:mga03n38_42210_c1
272 nmdc:mga00v17_116670_c1
273 nmdc:mga00v17_303252_c1
274 nmdc:mga0yw44_125003_c1
275 nmdc:mga0yw44_16513_c1
276 nmdc:mga0yw44_213742_c1
277 nmdc:mga0yw44_223926_c1
278 nmdc:mga0k408_107540_c1
279 nmdc:mga0k408_155808_c1
280 nmdc:mga0k408_192232_c1
281 nmdc:mga06z11_10602_c1
282 nmdc:mga06z11_342554_c1
283 nmdc:mga06z11_3503_c1
284 nmdc:mga06z11_47254_c1
285 nmdc:mga07m45_56554_c1
286 nmdc:mga07m45_6029_c1
287 nmdc:mga0sz30_18207_c1
288 nmdc:mga0sz30_20720_c1
289 nmdc:mga0sz30_394_c1
290 nmdc:mga0sz30_48392_c1
291 Ga0500647_0013219
292 Ga0500641_0000512
293 Ga0500568_0015594
294 Ga0500616_0000925
295 Ga0500620_121876
296 Ga0500552_000257

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00582

Usp

Universal stress protein family

32

173

0.85

PF00582

Usp

Universal stress protein family

184

308

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ab8-assembly1.cif.gz_B crystal structure of the hypothetical tandem-type universal stress protein ttha0350 complexed with atps. 0.8351 5 278
3ab8-assembly1.cif.gz_B crystal structure of the hypothetical tandem-type universal stress protein ttha0350 complexed with atps. 0.8292 5 278
3ab7-assembly2.cif.gz_A crystal structure of the hypothetical tandem-type universal stress protein ttha0350 from thermus thermophilus hb8 0.8228 5 278
3ab8-assembly1.cif.gz_A crystal structure of the hypothetical tandem-type universal stress protein ttha0350 complexed with atps. 0.8221 5 278
3ab7-assembly2.cif.gz_A crystal structure of the hypothetical tandem-type universal stress protein ttha0350 from thermus thermophilus hb8 0.8166 5 278
ID Description Score Start End Superfamily
3ab8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8351 5 278 3.40.50.12370
3ab8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8292 5 278 3.40.50.12370
af_Q9FI65_39_150_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8249 4 105 3.40.50.620
af_Q57951_25_170_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8186 3 144 3.40.50.620
af_A0A1D6J571_14_177_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8115 4 144 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A1F3ZUP2-F1-model_v4 UspA domain-containing protein 0.9307 1 278
AF-A0A1F3ZUP2-F1-model_v4 UspA domain-containing protein 0.9275 1 278
AF-A0A251X9D5-F1-model_v4 UspA domain-containing protein 0.9251 1 278
AF-A0A158J533-F1-model_v4 Universal stress protein family protein 0.9243 1 278
AF-A0A251X9D5-F1-model_v4 UspA domain-containing protein 0.9218 1 278

Map