F203172

General Info

Members Datasets Scaffolds Average Seq Length
148 115 296 272

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10223954|Ga0157369_102239542
Length 290
Sequence MRSVSGVEPAGAGKVSTGYAGKVTVTLRRDAAPGESARAMRHWWDRQAGDYYAEHGDYLGDADFVWSPENVRERDVQLLGDVAGLAGRRVLEVGCGAAQCSRWLRAQGAEPVAFDVSGGQLAKGRDLAARTGITVPLVQADAQRLPFRDESFDVACSAYGAVPFVADSAAVMSEVARVLRPGGRWVFATTHPFRWCFRDDPGPDGLVVESSYFDRRAYVEEDGRGATTYVEHHRTIGDRIREIVAAGLVLDDLVEPEWPDDHKQPWGQWSPLRGRLMPGTAIFVTHKSVT

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
24 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
25 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
26 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
27 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
28 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
29 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
30 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
47 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
48 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
49 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
50 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
51 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
52 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
53 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
54 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
59 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
60 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
61 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
62 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
63 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
64 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
65 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
66 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
67 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
68 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
71 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
72 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
74 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
75 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
76 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
77 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
78 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
79 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
80 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
81 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
82 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
83 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
84 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
85 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
86 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
87 2501939600 Micromonospora sp. L5 Isolate Unclassified
88 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
89 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
90 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
91 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
92 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
93 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
94 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
95 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
96 2855683550 Micromonospora sp. RP3T Isolate Unclassified
97 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
98 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
99 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
100 2858868258 Micromonospora sp. MH33 Isolate Unclassified
101 2858882152 Micromonospora noduli MED15 Isolate Nodule
102 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
103 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
104 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
105 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
106 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
107 2902582711 Micromonospora sp. AP08 Isolate Unclassified
108 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
109 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
110 649633069 Micromonospora sp. L5 Isolate Unclassified
111 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
112 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
113 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
114 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
115 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 80.41
Metatranscriptomes 0
Isolates 19.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.38
Nodule 3.38
Rhizoplane 0.68
Rhizosphere 66.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10223954 3300013105 Bacteria 1968
2 rootH1_10055033 3300003316 Bacteria 1373
3 rootH1_10079324 3300003316 Bacteria 1685
4 rootH2_10038254 3300003320 Bacteria 2232
5 Ga0070658_10002264 3300005327 Bacteria 16160
6 Ga0070658_10028078 3300005327 Bacteria 4516
7 Ga0070658_10129266 3300005327 Bacteria 2104
8 Ga0070683_100131947 3300005329 Bacteria 2364
9 Ga0070680_100047205 3300005336 Bacteria 3506
10 Ga0068868_100446069 3300005338 Bacteria 1125
11 Ga0070668_100087776 3300005347 Bacteria 2447
12 Ga0070668_100296687 3300005347 Bacteria 1354
13 Ga0070659_100088631 3300005366 Bacteria 2478
14 Ga0070667_100015843 3300005367 Bacteria 6236
15 Ga0070667_100094712 3300005367 Bacteria 2573
16 Ga0070667_100256544 3300005367 Bacteria 1564
17 Ga0070700_100000007 3300005441 Bacteria 198866
18 Ga0070679_100128740 3300005530 Bacteria 2513
19 Ga0070679_100286295 3300005530 Bacteria 1600
20 Ga0070684_100147833 3300005535 Bacteria 2128
21 Ga0070684_100178952 3300005535 Bacteria 1927
22 Ga0070665_100703186 3300005548 Bacteria 1024
23 Ga0068861_100040394 3300005719 Bacteria 3489
24 Ga0068863_100331851 3300005841 Bacteria 1478
25 Ga0068860_100286273 3300005843 Bacteria 1611
26 Ga0081539_10009003 3300005985 Bacteria 8484
27 Ga0081539_10012016 3300005985 Bacteria 6741
28 Ga0081539_10023764 3300005985 Bacteria 4003
29 Ga0081539_10035470 3300005985 Bacteria 2997
30 Ga0081539_10036446 3300005985 Bacteria 2944
31 Ga0075430_100000755 3300006846 Bacteria 24936
32 Ga0111539_10412191 3300009094 Bacteria 1574
33 Ga0105245_10586972 3300009098 Bacteria 1139
34 Ga0114129_10667316 3300009147 Bacteria 1340
35 Ga0114129_10720434 3300009147 Bacteria 1280
36 Ga0157373_10445814 3300013100 Bacteria 931
37 Ga0157371_10019395 3300013102 Bacteria 5017
38 Ga0157369_10002533 3300013105 Bacteria 21842
39 Ga0157369_10011997 3300013105 Bacteria 9843
40 Ga0157369_10094191 3300013105 Bacteria 3197
41 Ga0157369_10168330 3300013105 Bacteria 2310
42 Ga0157372_10455300 3300013307 Bacteria 1491
43 Ga0157375_10427657 3300013308 Bacteria 1490
44 Ga0163163_10094709 3300014325 Bacteria 3004
45 Ga0163163_10856489 3300014325 Bacteria 972
46 Ga0157379_10176516 3300014968 Bacteria 1929
47 Ga0157376_10212047 3300014969 Bacteria 1788
48 Ga0207680_10357889 3300025903 Bacteria 1026
49 Ga0207705_10001935 3300025909 Bacteria 16168
50 Ga0207705_10061142 3300025909 Bacteria 2721
51 Ga0207660_10388213 3300025917 Bacteria 1123
52 Ga0207652_10198259 3300025921 Bacteria 1807
53 Ga0207652_10439014 3300025921 Bacteria 1177
54 Ga0207687_10236641 3300025927 Bacteria 1445
55 Ga0207690_10067113 3300025932 Bacteria 2460
56 Ga0207686_10555244 3300025934 Bacteria 898
57 Ga0207661_10027458 3300025944 Bacteria 4348
58 Ga0207661_10337856 3300025944 Bacteria 1357
59 Ga0207668_10068707 3300025972 Bacteria 2520
60 Ga0207668_10297177 3300025972 Bacteria 1331
61 Ga0207658_10010676 3300025986 Bacteria 6243
62 Ga0207677_10195531 3300026023 Bacteria 1603
63 Ga0207703_10063152 3300026035 Bacteria 3036
64 Ga0207708_10000006 3300026075 Bacteria 266916
65 Ga0207641_10132707 3300026088 Bacteria 2238
66 Ga0207675_100105960 3300026118 Bacteria 2650
67 Ga0268265_10161422 3300028380 Bacteria 1904
68 Ga0307517_10229799 3300028786 Bacteria 1115
69 Ga0307515_10002318 3300028794 Bacteria 41560
70 Ga0307515_10010341 3300028794 Bacteria 17890
71 Ga0307515_10132724 3300028794 Bacteria 2730
72 Ga0307512_10004638 3300030522 Bacteria 14920
73 Ga0307512_10085059 3300030522 Bacteria 2244
74 Ga0307513_10016829 3300031456 Bacteria 8798
75 Ga0307513_10073065 3300031456 Bacteria 3572
76 Ga0307509_10039334 3300031507 Bacteria 5154
77 Ga0307508_10000544 3300031616 Bacteria 44618
78 Ga0307508_10035773 3300031616 Bacteria 4475
79 Ga0307508_10095063 3300031616 Bacteria 2571
80 Ga0307516_10011039 3300031730 Bacteria 9871
81 Ga0307516_10156514 3300031730 Bacteria 2033
82 Ga0307413_10055357 3300031824 Bacteria 2413
83 Ga0307410_10220240 3300031852 Bacteria 1460
84 Ga0307406_10179525 3300031901 Bacteria 1540
85 Ga0307409_100117751 3300031995 Bacteria 2242
86 Ga0307409_100192850 3300031995 Bacteria 1815
87 Ga0307416_100052891 3300032002 Bacteria 3254
88 Ga0307507_10243999 3300033179 Bacteria 1171
89 Ga0373938_0004021 3300034957 Bacteria 2432
90 Ga0373951_0000091 3300035091 Bacteria 34997
91 Ga0373942_0000538 3300035207 Bacteria 10630
92 Ga0373962_0015391 3300035242 Bacteria 1960
93 Ga0373935_0010616 3300035692 Bacteria 5528
94 Ga0436364_0782944 3300037853 Bacteria 1692
95 Ga0439448_0013229 3300042005 Bacteria 2478
96 Ga0466963_0106601 3300044694 Bacteria 1921
97 Ga0466957_0055892 3300044842 Bacteria 2412
98 Ga0466958_0054928 3300045836 Bacteria 2416
99 Ga0466967_0258865 3300045976 Bacteria 1664
100 Ga0466967_0296729 3300045976 Bacteria 1554
101 Ga0495632_0044756 3300046519 Bacteria 2208
102 Ga0496108_0000050 3300048911 Bacteria 131829
103 Ga0501047_0073689 3300049581 Bacteria 3287
104 Ga0501070_0043637 3300049586 Bacteria 3731
105 Ga0501073_0089397 3300049589 Bacteria 2141
106 Ga0501074_0012309 3300049590 Bacteria 6218
107 Ga0501079_0001358 3300049741 Bacteria 17211
108 Ga0501079_0441925 3300049741 Bacteria 1021
109 Ga0501080_0003965 3300049742 Bacteria 13106
110 Ga0501044_0382169 3300049823 Bacteria 1323
111 nmdc:mga05p37_795660_c1 3300050507 Bacteria 1035
112 nmdc:mga0qj67_20756_c1 3300050509 Bacteria 5030
113 nmdc:mga0qj67_252625_c1 3300050509 Bacteria 1430
114 nmdc:mga08y16_339118_c1 3300050511 Bacteria 1545
115 Ga0500644_0039788 3300053088 Bacteria 1552
116 Ga0500646_0052968 3300053090 Bacteria 1176
117 Ga0500583_0118661 3300053092 Bacteria 1308
118 Ga0500652_031376 3300053131 Bacteria 2084
119 Ga0500579_059644 3300053143 Bacteria 2275
120 2501940029 2501939600 Bacteria 6907073
121 2515722547 2515154129 Bacteria 5584369
122 2516085423 2515154202 Bacteria 5471270
123 2623590716 2622736626 Bacteria 7181580
124 2753268207 2751185782 Bacteria 11227053
125 2772644320 2772190715 Bacteria 6959372
126 2831937424 2831935698 Bacteria 5963223
127 2855675358 2855670206 Bacteria 7120389
128 2855680705 2855676851 Bacteria 7063653
129 2855684593 2855683550 Bacteria 7134265
130 2856864374 2856858025 Bacteria 7255264
131 2857293986 2857288857 Bacteria 7189066
132 2858852138 2858848962 Bacteria 6963058
133 2858870342 2858868258 Bacteria 7683772
134 2858886192 2858882152 Bacteria 7230291
135 2858888858 2858888857 Bacteria 7060307
136 2858898131 2858895516 Bacteria 7378898
137 2869073851 2869068681 Bacteria 7205615
138 2880489803 2880489317 Bacteria 7096270
139 2880502784 2880495981 Bacteria 7340502
140 2902583541 2902582711 Bacteria 6187705
141 2929224581 2929219909 Bacteria 6984360
142 2929232482 2929226422 Bacteria 7248583
143 649814099 649633069 Bacteria 6962533
144 8003858257 8003856774 Bacteria 7675274
145 8054707887 8054704163 Bacteria 7247792
146 8054731857 8054727385 Bacteria 7558670
147 8054738055 8054734606 Bacteria 6947278
148 8056060824 8056060235 Bacteria 7259403
149 Ga0157369_10223954
150 rootH1_10055033
151 rootH1_10079324
152 rootH2_10038254
153 Ga0070658_10002264
154 Ga0070658_10028078
155 Ga0070658_10129266
156 Ga0070683_100131947
157 Ga0070680_100047205
158 Ga0068868_100446069
159 Ga0070668_100087776
160 Ga0070668_100296687
161 Ga0070659_100088631
162 Ga0070667_100015843
163 Ga0070667_100094712
164 Ga0070667_100256544
165 Ga0070700_100000007
166 Ga0070679_100128740
167 Ga0070679_100286295
168 Ga0070684_100147833
169 Ga0070684_100178952
170 Ga0070665_100703186
171 Ga0068861_100040394
172 Ga0068863_100331851
173 Ga0068860_100286273
174 Ga0081539_10009003
175 Ga0081539_10012016
176 Ga0081539_10023764
177 Ga0081539_10035470
178 Ga0081539_10036446
179 Ga0075430_100000755
180 Ga0111539_10412191
181 Ga0105245_10586972
182 Ga0114129_10667316
183 Ga0114129_10720434
184 Ga0157373_10445814
185 Ga0157371_10019395
186 Ga0157369_10002533
187 Ga0157369_10011997
188 Ga0157369_10094191
189 Ga0157369_10168330
190 Ga0157372_10455300
191 Ga0157375_10427657
192 Ga0163163_10094709
193 Ga0163163_10856489
194 Ga0157379_10176516
195 Ga0157376_10212047
196 Ga0207680_10357889
197 Ga0207705_10001935
198 Ga0207705_10061142
199 Ga0207660_10388213
200 Ga0207652_10198259
201 Ga0207652_10439014
202 Ga0207687_10236641
203 Ga0207690_10067113
204 Ga0207686_10555244
205 Ga0207661_10027458
206 Ga0207661_10337856
207 Ga0207668_10068707
208 Ga0207668_10297177
209 Ga0207658_10010676
210 Ga0207677_10195531
211 Ga0207703_10063152
212 Ga0207708_10000006
213 Ga0207641_10132707
214 Ga0207675_100105960
215 Ga0268265_10161422
216 Ga0307517_10229799
217 Ga0307515_10002318
218 Ga0307515_10010341
219 Ga0307515_10132724
220 Ga0307512_10004638
221 Ga0307512_10085059
222 Ga0307513_10016829
223 Ga0307513_10073065
224 Ga0307509_10039334
225 Ga0307508_10000544
226 Ga0307508_10035773
227 Ga0307508_10095063
228 Ga0307516_10011039
229 Ga0307516_10156514
230 Ga0307413_10055357
231 Ga0307410_10220240
232 Ga0307406_10179525
233 Ga0307409_100117751
234 Ga0307409_100192850
235 Ga0307416_100052891
236 Ga0307507_10243999
237 Ga0373938_0004021
238 Ga0373951_0000091
239 Ga0373942_0000538
240 Ga0373962_0015391
241 Ga0373935_0010616
242 Ga0436364_0782944
243 Ga0439448_0013229
244 Ga0466963_0106601
245 Ga0466957_0055892
246 Ga0466958_0054928
247 Ga0466967_0258865
248 Ga0466967_0296729
249 Ga0495632_0044756
250 Ga0496108_0000050
251 Ga0501047_0073689
252 Ga0501070_0043637
253 Ga0501073_0089397
254 Ga0501074_0012309
255 Ga0501079_0001358
256 Ga0501079_0441925
257 Ga0501080_0003965
258 Ga0501044_0382169
259 nmdc:mga05p37_795660_c1
260 nmdc:mga0qj67_20756_c1
261 nmdc:mga0qj67_252625_c1
262 nmdc:mga08y16_339118_c1
263 Ga0500644_0039788
264 Ga0500646_0052968
265 Ga0500583_0118661
266 Ga0500652_031376
267 Ga0500579_059644
268 2501940029
269 2515722547
270 2516085423
271 2623590716
272 2753268207
273 2772644320
274 2831937424
275 2855675358
276 2855680705
277 2855684593
278 2856864374
279 2857293986
280 2858852138
281 2858870342
282 2858886192
283 2858888858
284 2858898131
285 2869073851
286 2880489803
287 2880502784
288 2902583541
289 2929224581
290 2929232482
291 649814099
292 8003858257
293 8054707887
294 8054731857
295 8054738055
296 8056060824

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

91

187

0.97

PF13649

Methyltransf_25

Methyltransferase domain

90

183

0.96

PF03141

Methyltransf_29

Putative S-adenosyl-L-methionine-dependent methyltransferase

70

197

0.9

PF13847

Methyltransf_31

Methyltransferase domain

85

204

0.9

PF08242

Methyltransf_12

Methyltransferase domain

91

185

0.88

PF13489

Methyltransf_23

Methyltransferase domain

69

229

0.87

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

72

197

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5una-assembly2.cif.gz_B fragment of 7sk snrna methylphosphate capping enzyme 0.869 57 167
5una-assembly6.cif.gz_F fragment of 7sk snrna methylphosphate capping enzyme 0.8664 57 167
5una-assembly4.cif.gz_D fragment of 7sk snrna methylphosphate capping enzyme 0.8653 57 167
3ege-assembly1.cif.gz_A crystal structure of putative methyltransferase from antibiotic biosynthesis pathway (yp_324569.1) from anabaena variabilis atcc 29413 at 2.40 a resolution 0.847 48 165
2zbq-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methyltransferase from thermus thermophilus in complex with s-adenosyl-l-homocysteine 0.8413 52 258
ID Description Score Start End Superfamily
af_I1NIB5_41_259_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8996 54 159 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8861 55 114 3.40.50.150
af_A0A1D8PSY8_4_290_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8795 49 164 3.40.50.150
af_Q54LU3_44_217_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.875 48 159 3.40.50.150
af_Q54PP5_28_226_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8724 51 152 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2W6DFW3-F1-model_v4 SAM-dependent methyltransferase 0.9769 2 262 GO:0008168
GO:0032259
AF-A0A7W0U1J5-F1-model_v4 Class I SAM-dependent methyltransferase 0.9731 2 260 GO:0008168
GO:0032259
AF-A0A7K3WAJ5-F1-model_v4 Class I SAM-dependent methyltransferase 0.9718 2 260 GO:0008757
GO:0032259
AF-A0A2W6DFW3-F1-model_v4 SAM-dependent methyltransferase 0.9695 2 262 GO:0008168
GO:0032259
AF-A0A223Q6F6-F1-model_v4 deleted 0.9687 2 258

Map