F202555

General Info

Members Datasets Scaffolds Average Seq Length
148 98 148 228

Family's Representative Sequence

Representative Sequence 3300005466|Ga0070685_10069182|Ga0070685_100691821
Length 277
Sequence VRYLSGLCFFKAKHPTTNIEHPTPNNWNERLTDWVLIVGCFYVHLLSSAPMNGNTQLTFIKEDPWRIFRIMAEFVDSFETLSQVGPGVTVFGSARILPNNPYYKATVHLARELAKHNLAVITGGGPGVMEAANRGATAAKGKSVGLNIELPHEQRGNPYANIPIHFHYFFARKVCFVKYSIAFVFMPGGFGTLDEFFEVLTLVQTGRIPEFPLILFGRDHWQGLIQWMKKKLVPGKFINPGDLELFTITDDPQEVVDIIQDYMRRVGPPEVMPKAFA

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
54 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
55 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
56 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
57 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
58 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
59 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
60 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
61 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
62 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
63 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
64 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
65 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
66 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
67 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
68 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
69 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
70 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
71 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
72 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
73 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
74 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
75 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
76 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
77 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
78 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
79 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
80 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
81 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
82 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
83 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
86 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
87 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
88 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
89 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
90 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
91 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
92 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
93 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
94 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
95 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
96 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
97 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
98 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.35
Nodule 0
Rhizoplane 1.35
Rhizosphere 97.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10238235 3300005293 Bacteria 1208
2 Ga0070658_10082909 3300005327 Bacteria 2635
3 Ga0070690_100287876 3300005330 Bacteria 1174
4 Ga0070680_100735501 3300005336 Bacteria 849
5 Ga0070689_100051659 3300005340 Bacteria 3178
6 Ga0070689_100107475 3300005340 Bacteria 2215
7 Ga0070691_10039294 3300005341 Bacteria 2236
8 Ga0070711_100270606 3300005439 Bacteria 1340
9 Ga0070708_100047566 3300005445 Bacteria 3790
10 Ga0070681_10134358 3300005458 Bacteria 2405
11 Ga0070681_10230497 3300005458 Bacteria 1766
12 Ga0068867_100140581 3300005459 Bacteria 1887
13 Ga0070685_10069182 3300005466 Bacteria 2087
14 Ga0070679_100421587 3300005530 Bacteria 1280
15 Ga0070679_100436921 3300005530 Bacteria 1254
16 Ga0070684_100154982 3300005535 Bacteria 2077
17 Ga0070686_100400501 3300005544 Bacteria 1044
18 Ga0070695_100679587 3300005545 Bacteria 815
19 Ga0068855_100041463 3300005563 Bacteria 5455
20 Ga0068855_100119562 3300005563 Bacteria 3016
21 Ga0068855_100195708 3300005563 Bacteria 2278
22 Ga0068855_100282231 3300005563 Bacteria 1844
23 Ga0068857_100003376 3300005577 Bacteria 13287
24 Ga0068856_100000333 3300005614 Bacteria 51689
25 Ga0068856_100069418 3300005614 Bacteria 3484
26 Ga0070702_100026596 3300005615 Bacteria 3111
27 Ga0068859_100802226 3300005617 Bacteria 1029
28 Ga0070715_10109476 3300006163 Bacteria 1301
29 Ga0097621_100005006 3300006237 Bacteria 9293
30 Ga0068871_100001295 3300006358 Bacteria 16726
31 Ga0075434_100277854 3300006871 Bacteria 1694
32 Ga0097620_100802103 3300006931 Bacteria 1029
33 Ga0105240_10003358 3300009093 Bacteria 24897
34 Ga0105240_10292233 3300009093 Bacteria 1868
35 Ga0105240_10569518 3300009093 Bacteria 1251
36 Ga0111539_10023253 3300009094 Bacteria 7613
37 Ga0105245_10257473 3300009098 Bacteria 1697
38 Ga0105245_10469682 3300009098 Bacteria 1269
39 Ga0114129_10130996 3300009147 Bacteria 3444
40 Ga0105242_10916212 3300009176 Bacteria 878
41 Ga0105238_10006351 3300009551 Bacteria 11756
42 Ga0105238_10080295 3300009551 Bacteria 3251
43 Ga0105238_10141438 3300009551 Bacteria 2383
44 Ga0157370_10050719 3300013104 Bacteria 3966
45 Ga0157370_10677207 3300013104 Bacteria 942
46 Ga0157374_10289400 3300013296 Unclassified 1619
47 Ga0157374_10575534 3300013296 Bacteria 1135
48 Ga0157378_10065951 3300013297 Bacteria 3241
49 Ga0157372_10119706 3300013307 Bacteria 3023
50 Ga0157372_10451406 3300013307 Bacteria 1498
51 Ga0157375_10000535 3300013308 Bacteria 34074
52 Ga0157375_10120759 3300013308 Unclassified 2730
53 Ga0163163_10000909 3300014325 Bacteria 25086
54 Ga0163163_10666010 3300014325 Bacteria 1104
55 Ga0207705_10361506 3300025909 Bacteria 1119
56 Ga0207707_10081004 3300025912 Bacteria 2834
57 Ga0207707_10179727 3300025912 Bacteria 1847
58 Ga0207695_10212952 3300025913 Bacteria 1842
59 Ga0207657_10531499 3300025919 Bacteria 920
60 Ga0207652_10386221 3300025921 Bacteria 1263
61 Ga0207694_10069520 3300025924 Bacteria 2751
62 Ga0207694_10088394 3300025924 Bacteria 2443
63 Ga0207664_10004167 3300025929 Bacteria 9762
64 Ga0207665_10356327 3300025939 Bacteria 1105
65 Ga0207667_10057099 3300025949 Bacteria 4099
66 Ga0207667_10133116 3300025949 Bacteria 2561
67 Ga0207667_10136309 3300025949 Unclassified 2528
68 Ga0207667_10254520 3300025949 Bacteria 1796
69 Ga0207677_10412723 3300026023 Bacteria 1148
70 Ga0207702_10000259 3300026078 Bacteria 61188
71 Ga0207702_11145524 3300026078 Bacteria 772
72 Ga0207676_10203055 3300026095 Bacteria 1753
73 Ga0207674_10007808 3300026116 Bacteria 12441
74 Ga0207674_10462805 3300026116 Bacteria 1226
75 Ga0207428_10246404 3300027907 Bacteria 1333
76 Ga0207428_10400898 3300027907 Bacteria 1004
77 Ga0265338_10000284 3300028800 Bacteria 91363
78 Ga0265338_10003441 3300028800 Bacteria 22307
79 Ga0265338_10003611 3300028800 Bacteria 21590
80 Ga0265338_10011808 3300028800 Bacteria 10038
81 Ga0265338_10016132 3300028800 Bacteria 8150
82 Ga0265338_10329296 3300028800 Bacteria 1103
83 Ga0265324_10000258 3300029957 Bacteria 39319
84 Ga0265324_10019497 3300029957 Bacteria 2443
85 Ga0265324_10021462 3300029957 Bacteria 2315
86 Ga0265320_10020223 3300031240 Bacteria 3615
87 Ga0265314_10058985 3300031711 Bacteria 2628
88 Ga0373923_0244366 3300035111 Bacteria 839
89 Ga0373931_0279170 3300035691 Bacteria 1025
90 Ga0373935_0508535 3300035692 Bacteria 875
91 Ga0373927_0065754 3300035695 Bacteria 2345
92 Ga0373947_0003822 3300035725 Bacteria 8868
93 Ga0373925_0249076 3300037068 Bacteria 1424
94 Ga0373925_0692752 3300037068 Bacteria 840
95 Ga0451577_0077327 3300042876 Bacteria 2967
96 Ga0453684_0016193 3300044712 Bacteria 11685
97 Ga0453684_0184081 3300044712 Bacteria 2450
98 Ga0453684_0569665 3300044712 Bacteria 1245
99 Ga0451576_0226291 3300045051 Unclassified 1953
100 Ga0451576_0230799 3300045051 Bacteria 1933
101 Ga0495592_0002714 3300046454 Bacteria 12530
102 Ga0495592_0214442 3300046454 Bacteria 1291
103 Ga0495592_0231404 3300046454 Bacteria 1230
104 Ga0495639_0016464 3300046475 Bacteria 3211
105 Ga0495662_0020667 3300046476 Bacteria 3184
106 Ga0495664_0308710 3300046477 Bacteria 954
107 Ga0495608_0263397 3300046511 Bacteria 1073
108 Ga0495618_0002153 3300046514 Bacteria 12899
109 Ga0495618_0177035 3300046514 Bacteria 1356
110 Ga0495628_0000099 3300046516 Bacteria 69768
111 Ga0495628_0106430 3300046516 Bacteria 2160
112 Ga0495628_0130545 3300046516 Bacteria 1922
113 Ga0495630_0002993 3300046517 Bacteria 11717
114 Ga0495630_0006737 3300046517 Bacteria 8188
115 Ga0495630_0097231 3300046517 Bacteria 2227
116 Ga0495630_0101786 3300046517 Bacteria 2173
117 Ga0495666_0041878 3300046526 Bacteria 2216
118 Ga0495652_0270963 3300046529 Bacteria 1248
119 Ga0495640_0025571 3300046533 Bacteria 4280
120 Ga0495586_0000743 3300046535 Bacteria 18699
121 Ga0495586_0000829 3300046535 Bacteria 17769
122 Ga0495586_0073536 3300046535 Bacteria 1870
123 Ga0495645_0034392 3300046543 Bacteria 3698
124 Ga0495645_0069668 3300046543 Bacteria 2539
125 Ga0495667_0073167 3300046559 Bacteria 2233
126 Ga0495634_0032349 3300046642 Unclassified 3597
127 Ga0495588_0194993 3300046674 Bacteria 1070
128 Ga0495599_0125747 3300046678 Bacteria 1593
129 Ga0495647_0002779 3300046681 Bacteria 5551
130 Ga0495658_0003419 3300046683 Bacteria 7856
131 Ga0495613_0011966 3300046689 Bacteria 6448
132 Ga0495624_0027440 3300046690 Bacteria 3728
133 Ga0495604_0255464 3300047317 Bacteria 1193
134 Ga0495674_0033814 3300047319 Bacteria 4627
135 Ga0495674_0059797 3300047319 Bacteria 3327
136 Ga0495675_0037901 3300047444 Bacteria 3070
137 Ga0496106_0017748 3300048909 Bacteria 5263
138 Ga0496115_0019914 3300048918 Bacteria 5170
139 nmdc:mga06r32_255698_c1 3300050510 Bacteria 1739
140 nmdc:mga08y16_34759_c1 3300050511 Bacteria 5295
141 nmdc:mga08y16_59481_c1 3300050511 Bacteria 3990
142 nmdc:mga08y16_62156_c1 3300050511 Bacteria 3899
143 nmdc:mga0n895_297331_c1 3300050512 Unclassified 1637
144 nmdc:mga0rr50_867498_c1 3300050513 Bacteria 770
145 nmdc:mga0a205_283634_c1 3300050515 Bacteria 1531
146 Ga0495601_0162955 3300053077 Bacteria 1457
147 Ga0500651_0107741 3300053093 Bacteria 1703
148 Ga0500650_0001035 3300053098 Bacteria 7940

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005340 Ga0070689_100107475 Ga0070689_1001074752 223
2 3300028800 Ga0265338_10000284 Ga0265338_1000028461 223
3 3300028800 Ga0265338_10003441 Ga0265338_1000344124 223
4 3300029957 Ga0265324_10000258 Ga0265324_1000025844 223
5 3300005614 Ga0068856_100069418 Ga0068856_1000694182 225
6 3300006163 Ga0070715_10109476 Ga0070715_101094762 225
7 3300009094 Ga0111539_10023253 Ga0111539_100232532 225
8 3300009147 Ga0114129_10130996 Ga0114129_101309963 225
9 3300009551 Ga0105238_10141438 Ga0105238_101414382 225
10 3300027907 Ga0207428_10246404 Ga0207428_102464042 225
11 3300027907 Ga0207428_10400898 Ga0207428_104008982 225
12 3300028800 Ga0265338_10003611 Ga0265338_1000361112 225
13 3300028800 Ga0265338_10016132 Ga0265338_100161322 225
14 3300028800 Ga0265338_10329296 Ga0265338_103292962 225
15 3300029957 Ga0265324_10019497 Ga0265324_100194974 225
16 3300029957 Ga0265324_10021462 Ga0265324_100214623 225
17 3300031711 Ga0265314_10058985 Ga0265314_100589852 225
18 3300046517 Ga0495630_0101786 Ga0495630_0101786_83_760 225
19 3300050511 nmdc:mga08y16_34759_c1 nmdc:mga08y16_34759_c1_3235_3915 225
20 3300050511 nmdc:mga08y16_62156_c1 nmdc:mga08y16_62156_c1_2240_2920 225
21 3300053098 Ga0500650_0001035 Ga0500650_0001035_2487_3203 225
22 3300005340 Ga0070689_100051659 Ga0070689_1000516593 226
23 3300005445 Ga0070708_100047566 Ga0070708_1000475661 226
24 3300005530 Ga0070679_100436921 Ga0070679_1004369212 226
25 3300005544 Ga0070686_100400501 Ga0070686_1004005011 226
26 3300005545 Ga0070695_100679587 Ga0070695_1006795871 226
27 3300006871 Ga0075434_100277854 Ga0075434_1002778541 226
28 3300009098 Ga0105245_10469682 Ga0105245_104696822 226
29 3300025939 Ga0207665_10356327 Ga0207665_103563271 226
30 3300035691 Ga0373931_0279170 Ga0373931_0279170_292_972 226
31 3300037068 Ga0373925_0249076 Ga0373925_0249076_733_1413 226
32 3300037068 Ga0373925_0692752 Ga0373925_0692752_76_756 226
33 3300042876 Ga0451577_0077327 Ga0451577_0077327_1113_1793 226
34 3300044712 Ga0453684_0184081 Ga0453684_0184081_1164_1844 226
35 3300044712 Ga0453684_0569665 Ga0453684_0569665_72_776 226
36 3300046454 Ga0495592_0214442 Ga0495592_0214442_433_1116 226
37 3300046516 Ga0495628_0106430 Ga0495628_0106430_425_1108 226
38 3300046674 Ga0495588_0194993 Ga0495588_0194993_11_691 226
39 3300048909 Ga0496106_0017748 Ga0496106_0017748_3884_4564 226
40 3300050510 nmdc:mga06r32_255698_c1 nmdc:mga06r32_255698_c1_336_1016 226
41 3300050511 nmdc:mga08y16_59481_c1 nmdc:mga08y16_59481_c1_3203_3949 226
42 3300050512 nmdc:mga0n895_297331_c1 nmdc:mga0n895_297331_c1_180_872 226
43 3300050515 nmdc:mga0a205_283634_c1 nmdc:mga0a205_283634_c1_386_1066 226
44 3300005293 Ga0065715_10238235 Ga0065715_102382351 227
45 3300005327 Ga0070658_10082909 Ga0070658_100829091 227
46 3300005330 Ga0070690_100287876 Ga0070690_1002878761 227
47 3300005336 Ga0070680_100735501 Ga0070680_1007355011 227
48 3300005341 Ga0070691_10039294 Ga0070691_100392942 227
49 3300005439 Ga0070711_100270606 Ga0070711_1002706061 227
50 3300005458 Ga0070681_10134358 Ga0070681_101343582 227
51 3300005458 Ga0070681_10230497 Ga0070681_102304972 227
52 3300005459 Ga0068867_100140581 Ga0068867_1001405812 227
53 3300005466 Ga0070685_10069182 Ga0070685_100691821 227
54 3300005530 Ga0070679_100421587 Ga0070679_1004215872 227
55 3300005535 Ga0070684_100154982 Ga0070684_1001549822 227
56 3300005563 Ga0068855_100041463 Ga0068855_1000414637 227
57 3300005563 Ga0068855_100119562 Ga0068855_1001195622 227
58 3300005563 Ga0068855_100195708 Ga0068855_1001957082 227
59 3300005563 Ga0068855_100282231 Ga0068855_1002822313 227
60 3300005577 Ga0068857_100003376 Ga0068857_10000337611 227
61 3300005614 Ga0068856_100000333 Ga0068856_1000003335 227
62 3300005615 Ga0070702_100026596 Ga0070702_1000265962 227
63 3300005617 Ga0068859_100802226 Ga0068859_1008022262 227
64 3300006237 Ga0097621_100005006 Ga0097621_1000050063 227
65 3300006358 Ga0068871_100001295 Ga0068871_1000012956 227
66 3300006931 Ga0097620_100802103 Ga0097620_1008021032 227
67 3300009093 Ga0105240_10003358 Ga0105240_100033584 227
68 3300009093 Ga0105240_10292233 Ga0105240_102922332 227
69 3300009093 Ga0105240_10569518 Ga0105240_105695182 227
70 3300009098 Ga0105245_10257473 Ga0105245_102574732 227
71 3300009176 Ga0105242_10916212 Ga0105242_109162121 227
72 3300009551 Ga0105238_10006351 Ga0105238_100063513 227
73 3300009551 Ga0105238_10080295 Ga0105238_100802953 227
74 3300013104 Ga0157370_10050719 Ga0157370_100507195 227
75 3300013104 Ga0157370_10677207 Ga0157370_106772071 227
76 3300013296 Ga0157374_10289400 Ga0157374_102894002 227
77 3300013296 Ga0157374_10575534 Ga0157374_105755342 227
78 3300013297 Ga0157378_10065951 Ga0157378_100659513 227
79 3300013307 Ga0157372_10119706 Ga0157372_101197063 227
80 3300013307 Ga0157372_10451406 Ga0157372_104514062 227
81 3300013308 Ga0157375_10000535 Ga0157375_100005354 227
82 3300013308 Ga0157375_10120759 Ga0157375_101207592 227
83 3300014325 Ga0163163_10000909 Ga0163163_1000090918 227
84 3300014325 Ga0163163_10666010 Ga0163163_106660101 227
85 3300025909 Ga0207705_10361506 Ga0207705_103615062 227
86 3300025912 Ga0207707_10081004 Ga0207707_100810042 227
87 3300025912 Ga0207707_10179727 Ga0207707_101797272 227
88 3300025913 Ga0207695_10212952 Ga0207695_102129521 227
89 3300025919 Ga0207657_10531499 Ga0207657_105314992 227
90 3300025921 Ga0207652_10386221 Ga0207652_103862212 227
91 3300025924 Ga0207694_10069520 Ga0207694_100695202 227
92 3300025924 Ga0207694_10088394 Ga0207694_100883942 227
93 3300025929 Ga0207664_10004167 Ga0207664_100041673 227
94 3300025949 Ga0207667_10057099 Ga0207667_100570992 227
95 3300025949 Ga0207667_10133116 Ga0207667_101331162 227
96 3300025949 Ga0207667_10136309 Ga0207667_101363094 227
97 3300025949 Ga0207667_10254520 Ga0207667_102545202 227
98 3300026023 Ga0207677_10412723 Ga0207677_104127232 227
99 3300026078 Ga0207702_10000259 Ga0207702_1000025912 227
100 3300026078 Ga0207702_11145524 Ga0207702_111455241 227
101 3300026095 Ga0207676_10203055 Ga0207676_102030551 227
102 3300026116 Ga0207674_10007808 Ga0207674_100078086 227
103 3300026116 Ga0207674_10462805 Ga0207674_104628051 227
104 3300028800 Ga0265338_10011808 Ga0265338_100118081 227
105 3300031240 Ga0265320_10020223 Ga0265320_100202231 227
106 3300035111 Ga0373923_0244366 Ga0373923_0244366_138_821 227
107 3300035692 Ga0373935_0508535 Ga0373935_0508535_64_747 227
108 3300035695 Ga0373927_0065754 Ga0373927_0065754_379_1062 227
109 3300035725 Ga0373947_0003822 Ga0373947_0003822_4751_5434 227
110 3300044712 Ga0453684_0016193 Ga0453684_0016193_2869_3552 227
111 3300045051 Ga0451576_0226291 Ga0451576_0226291_442_1125 227
112 3300045051 Ga0451576_0230799 Ga0451576_0230799_88_771 227
113 3300046454 Ga0495592_0002714 Ga0495592_0002714_3468_4151 227
114 3300046454 Ga0495592_0231404 Ga0495592_0231404_20_703 227
115 3300046475 Ga0495639_0016464 Ga0495639_0016464_1181_1867 227
116 3300046476 Ga0495662_0020667 Ga0495662_0020667_1906_2589 227
117 3300046477 Ga0495664_0308710 Ga0495664_0308710_65_748 227
118 3300046511 Ga0495608_0263397 Ga0495608_0263397_123_809 227
119 3300046514 Ga0495618_0002153 Ga0495618_0002153_11867_12550 227
120 3300046514 Ga0495618_0177035 Ga0495618_0177035_596_1282 227
121 3300046516 Ga0495628_0000099 Ga0495628_0000099_47185_47868 227
122 3300046516 Ga0495628_0130545 Ga0495628_0130545_22_705 227
123 3300046517 Ga0495630_0002993 Ga0495630_0002993_1399_2082 227
124 3300046517 Ga0495630_0006737 Ga0495630_0006737_4775_5458 227
125 3300046517 Ga0495630_0097231 Ga0495630_0097231_1502_2185 227
126 3300046526 Ga0495666_0041878 Ga0495666_0041878_582_1265 227
127 3300046529 Ga0495652_0270963 Ga0495652_0270963_324_1010 227
128 3300046533 Ga0495640_0025571 Ga0495640_0025571_3468_4151 227
129 3300046535 Ga0495586_0000743 Ga0495586_0000743_6241_6927 227
130 3300046535 Ga0495586_0000829 Ga0495586_0000829_7438_8121 227
131 3300046535 Ga0495586_0073536 Ga0495586_0073536_951_1634 227
132 3300046543 Ga0495645_0034392 Ga0495645_0034392_2046_2732 227
133 3300046543 Ga0495645_0069668 Ga0495645_0069668_865_1551 227
134 3300046559 Ga0495667_0073167 Ga0495667_0073167_830_1513 227
135 3300046642 Ga0495634_0032349 Ga0495634_0032349_2397_3083 227
136 3300046678 Ga0495599_0125747 Ga0495599_0125747_26_709 227
137 3300046681 Ga0495647_0002779 Ga0495647_0002779_3458_4144 227
138 3300046683 Ga0495658_0003419 Ga0495658_0003419_2643_3329 227
139 3300046689 Ga0495613_0011966 Ga0495613_0011966_4167_4853 227
140 3300046690 Ga0495624_0027440 Ga0495624_0027440_1838_2521 227
141 3300047317 Ga0495604_0255464 Ga0495604_0255464_415_1101 227
142 3300047319 Ga0495674_0033814 Ga0495674_0033814_2007_2690 227
143 3300047319 Ga0495674_0059797 Ga0495674_0059797_2563_3246 227
144 3300047444 Ga0495675_0037901 Ga0495675_0037901_227_913 227
145 3300048918 Ga0496115_0019914 Ga0496115_0019914_1769_2452 227
146 3300050513 nmdc:mga0rr50_867498_c1 nmdc:mga0rr50_867498_c1_25_711 227
147 3300053077 Ga0495601_0162955 Ga0495601_0162955_156_842 227
148 3300053093 Ga0500651_0107741 Ga0500651_0107741_263_973 227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03641

Lysine_decarbox

Possible lysine decarboxylase

129

259

0.96

PF18306

LDcluster4

SLOG cluster4 family

86

205

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wek-assembly1.cif.gz_E crystal structure of the conserved hypothetical protein tt1465 from thermus thermophilus hb8 0.9528 11 212
5wq3-assembly1.cif.gz_B-2 crystal structure of type-ii log from corynebacterium glutamicum 0.9525 11 215
1wek-assembly1.cif.gz_F crystal structure of the conserved hypothetical protein tt1465 from thermus thermophilus hb8 0.9483 13 211
1wek-assembly1.cif.gz_B crystal structure of the conserved hypothetical protein tt1465 from thermus thermophilus hb8 0.9409 8 210
5wq3-assembly1.cif.gz_C-3 crystal structure of type-ii log from corynebacterium glutamicum 0.9396 9 212
ID Description Score Start End Superfamily
5wq3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9562 14 215 3.40.50.450
1wekF01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9513 15 211 3.40.50.450
5wq3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.947 14 215 3.40.50.450
1wekF01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9369 15 211 3.40.50.450
af_Q4CYG8_66_324_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.902 37 212 3.40.50.450
ID Description Score Start End GO Terms
AF-K0MKC5-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9705 41 217 GO:0005829
GO:0008714
GO:0009691
AF-A0A1Q6ZDG4-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9682 35 216 GO:0005829
GO:0009691
GO:0016787
AF-A0A353C5L7-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9677 19 217 GO:0005829
GO:0009691
GO:0016787
AF-A0A349A3S3-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9675 43 212 GO:0005829
GO:0008714
GO:0009691
AF-A0A2G6KS44-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9674 18 216 GO:0005829
GO:0008714
GO:0009691

Feature Viewer

pLDDT pTM Quality
84.19 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map