F201356

General Info

Members Datasets Scaffolds Average Seq Length
147 122 97 326

Family's Representative Sequence

Representative Sequence 3300046648|Ga0495611_0001708|Ga0495611_0001708_229_1197
Length 316
Sequence MTLVPPPFDPELAAALEAVADTVPSSYTLDAVAGLRQAETAAMPTDEELSRGGFFGVEERAVPGPEGAPDVSLLICSPTVPDGPRPVFYSVHGGGMMLGNFRTGVDAVLDWAQELHAVVVSVEYRLAPEHPHPAPVEDVYAGLAWTAEHAEEIGGDPERIVIAGLTAALALLARDRKGPRPIGQVLMCPMLDDRNDTPSAHQMAGIDVWDRASNETGWTALLGDLRGGPDTSLYAAPARADDLSGLPPAFLDVGSAETFRDETVAYASRIWQAGGVAELHVWPGGFHGYESFAPRAALSQGTVAARMAWLRRLLGE

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2517572101 Frankia sp. DC12 Isolate Nodule
3 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
4 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
5 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
6 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
7 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
8 2619618881 Frankia sp. ACN1ag Isolate Unclassified
9 2619619003 Frankia sp. CpI1-P Isolate Nodule
10 2626541554 Frankia sp. AvcI.1 Isolate Nodule
11 2643221647 Streptomyces sp. Root369 Isolate Unclassified
12 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
13 2643221714 Streptomyces sp. Root264 Isolate Unclassified
14 2671180195 Frankia sp. CcI49 Isolate Nodule
15 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
16 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
17 2773857922 Frankia sp. CcI49 Isolate Nodule
18 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
19 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
20 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
21 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
22 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
23 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
24 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
25 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
26 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
27 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
28 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
29 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
30 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
31 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
32 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
33 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
34 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
35 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
36 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
37 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
38 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
39 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
53 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
54 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
55 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
56 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
57 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
58 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
59 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
60 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
61 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
62 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
63 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
66 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
67 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
68 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
69 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
70 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
71 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
72 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
76 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
77 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
78 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
79 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
80 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
81 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
82 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
85 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
86 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
87 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
88 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
89 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
90 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
91 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
92 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
93 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
94 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
95 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
96 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
97 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
98 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
99 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
100 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
101 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
102 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
103 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
104 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
105 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
111 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
112 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
113 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
114 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
115 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
116 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
117 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
118 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
119 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
120 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
121 8054920844 Frankia tisae Agncl-8 Isolate Nodule
122 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 65.31
Metatranscriptomes 0.68
Isolates 34.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.4
Nodule 9.52
Rhizoplane 0.68
Rhizosphere 61.22
Stem 0
Stem Tuber 0
Unclassified 25.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10069511 3300003322 Bacteria 3272
2 Ga0068869_100307834 3300005334 Bacteria 1281
3 Ga0068856_100125514 3300005614 Bacteria 2569
4 Ga0068863_100007502 3300005841 Bacteria 10669
5 Ga0068858_100000141 3300005842 Bacteria 76388
6 Ga0068858_100054637 3300005842 Bacteria 3693
7 Ga0081455_10000483 3300005937 Bacteria 51674
8 Ga0157379_10004369 3300014968 Bacteria 12093
9 Ga0207710_10000175 3300025900 Bacteria 65485
10 Ga0207647_10076985 3300025904 Bacteria 2006
11 Ga0207684_10028674 3300025910 Bacteria 4743
12 Ga0207703_10000147 3300026035 Bacteria 82822
13 Ga0207703_10095214 3300026035 Bacteria 2512
14 Ga0207702_10413997 3300026078 Bacteria 1302
15 Ga0207641_10003205 3300026088 Bacteria 14643
16 Ga0307517_10068554 3300028786 Bacteria 3229
17 Ga0307515_10000325 3300028794 Bacteria 118141
18 Ga0307515_10039951 3300028794 Bacteria 7436
19 Ga0307511_10000010 3300030521 Bacteria 146716
20 Ga0307511_10034966 3300030521 Bacteria 4398
21 Ga0307511_10057362 3300030521 Bacteria 3029
22 Ga0307513_10001575 3300031456 Bacteria 32715
23 Ga0307509_10049084 3300031507 Bacteria 4528
24 Ga0307509_10188154 3300031507 Bacteria 1919
25 Ga0307508_10159677 3300031616 Bacteria 1858
26 Ga0307514_10185005 3300031649 Bacteria 1337
27 Ga0307516_10017287 3300031730 Bacteria 7525
28 Ga0307516_10212481 3300031730 Bacteria 1648
29 Ga0307518_10060640 3300031838 Bacteria 2747
30 Ga0307518_10148033 3300031838 Bacteria 1628
31 Ga0307507_10106170 3300033179 Bacteria 2320
32 Ga0307510_10005756 3300033180 Bacteria 14772
33 Ga0307510_10090588 3300033180 Bacteria 2904
34 Ga0307510_10092013 3300033180 Bacteria 2872
35 Ga0372808_008671 3300036459 Bacteria 1412
36 Ga0395898_0014337 3300037466 Bacteria 8146
37 Ga0439436_0012930 3300041404 Bacteria 2529
38 Ga0439436_0058092 3300041404 Bacteria 1084
39 Ga0439439_0005583 3300041406 Bacteria 2879
40 Ga0439439_0042160 3300041406 Bacteria 1185
41 Ga0451853_0538786 3300041512 Bacteria 1155
42 Ga0439448_0027091 3300042005 Bacteria 1805
43 Ga0439449_0000141 3300042007 Bacteria 24575
44 Ga0439449_0033384 3300042007 Bacteria 1917
45 Ga0439455_0010794 3300042012 Bacteria 2017
46 Ga0439457_007292 3300042014 Bacteria 2661
47 Ga0439457_010291 3300042014 Bacteria 2154
48 Ga0450903_000033 3300042138 Bacteria 27469
49 Ga0466964_0021155 3300044706 Bacteria 2514
50 Ga0466967_0034224 3300045976 Bacteria 4310
51 Ga0466967_0183476 3300045976 Bacteria 1975
52 Ga0495592_0021622 3300046454 Bacteria 4894
53 Ga0495629_0104929 3300046459 Bacteria 1971
54 Ga0495606_0098361 3300046507 Bacteria 1785
55 Ga0495608_0127024 3300046511 Bacteria 1633
56 Ga0495618_0054522 3300046514 Bacteria 2530
57 Ga0495620_0019704 3300046515 Bacteria 3311
58 Ga0495643_0002665 3300046522 Bacteria 13811
59 Ga0495648_0035491 3300046524 Bacteria 3232
60 Ga0495652_0063204 3300046529 Bacteria 3118
61 Ga0495640_0030899 3300046533 Bacteria 3829
62 Ga0495668_0089926 3300046616 Bacteria 1682
63 Ga0495611_0001708 3300046648 Bacteria 10664
64 Ga0495625_0166559 3300046660 Bacteria 1473
65 Ga0495635_0051859 3300046663 Bacteria 2826
66 Ga0495657_0025242 3300046675 Bacteria 4223
67 Ga0495613_0030525 3300046689 Bacteria 4003
68 Ga0495613_0039084 3300046689 Bacteria 3517
69 Ga0495613_0065699 3300046689 Bacteria 2650
70 Ga0495649_0015755 3300046694 Bacteria 4298
71 Ga0495589_0008606 3300046794 Bacteria 5320
72 Ga0495581_0142857 3300047315 Bacteria 1397
73 Ga0495604_0149269 3300047317 Bacteria 1662
74 Ga0495636_0062698 3300047318 Bacteria 1574
75 Ga0495676_0016442 3300047321 Bacteria 6567
76 Ga0495680_0013917 3300047322 Bacteria 6999
77 Ga0495680_0060841 3300047322 Bacteria 2908
78 Ga0495687_002032 3300047443 Bacteria 17108
79 Ga0495687_076646 3300047443 Bacteria 1322
80 Ga0495675_0119165 3300047444 Bacteria 1644
81 Ga0495685_000697 3300047447 Bacteria 10270
82 Ga0495685_017899 3300047447 Bacteria 2428
83 Ga0495681_0003485 3300047470 Bacteria 10949
84 Ga0495614_0003166 3300048089 Bacteria 7345
85 Ga0495614_0061965 3300048089 Bacteria 1607
86 Ga0496117_0084134 3300048920 Bacteria 2077
87 Ga0496121_0007884 3300048924 Bacteria 12741
88 Ga0495678_077201 3300049459 Bacteria 1205
89 Ga0501033_0187667 3300049570 Bacteria 1480
90 Ga0501036_0001650 3300049572 Bacteria 17283
91 Ga0501047_0155184 3300049581 Bacteria 2163
92 Ga0501044_0001666 3300049823 Bacteria 26069
93 Ga0500610_0120504 3300053079 Bacteria 1342
94 Ga0500610_0184370 3300053079 Bacteria 1019
95 Ga0500644_0117995 3300053088 Bacteria 1031
96 Ga0500583_0020099 3300053092 Bacteria 2751
97 Ga0500600_0084594 3300053149 Bacteria 1707

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049459 Ga0495678_077201 Ga0495678_077201_336_1190 284
2 3300047318 Ga0495636_0062698 Ga0495636_0062698_688_1545 285
3 iso_pu_bacteria 8025478263 8025486138 298
4 3300042005 Ga0439448_0027091 Ga0439448_0027091_74_1051 304
5 3300042012 Ga0439455_0010794 Ga0439455_0010794_840_1817 304
6 3300042138 Ga0450903_000033 Ga0450903_000033_7614_8591 304
7 3300031456 Ga0307513_10001575 Ga0307513_1000157520 305
8 3300049570 Ga0501033_0187667 Ga0501033_0187667_386_1360 306
9 3300049572 Ga0501036_0001650 Ga0501036_0001650_10334_11308 306
10 3300046648 Ga0495611_0001708 Ga0495611_0001708_229_1197 316
11 3300005937 Ga0081455_10000483 Ga0081455_1000048322 317
12 iso_pu_bacteria 2558860112 2558907868 317
13 iso_pu_bacteria 2912723979 2912728646 317
14 iso_pu_bacteria 2862382967 2862386271 318
15 iso_pu_bacteria 8008558824 8008564433 318
16 iso_pu_bacteria 2751185782 2753270921 319
17 3300044706 Ga0466964_0021155 Ga0466964_0021155_605_1570 320
18 iso_pu_bacteria 2582581314 2585315025 320
19 iso_pu_bacteria 2643221678 2644440722 320
20 iso_pu_bacteria 2643221714 2644630219 320
21 iso_pu_bacteria 2808606359 2808845593 320
22 iso_pu_bacteria 2862382967 2862385103 320
23 iso_pu_bacteria 2946064051 2946071594 320
24 iso_pu_bacteria 2946072368 2946079390 320
25 iso_pu_bacteria 2947224130 2947225121 320
26 iso_pu_bacteria 2954711539 2954712573 320
27 iso_pu_bacteria 2954721474 2954722528 320
28 iso_pu_bacteria 2954731030 2954739330 320
29 iso_pu_bacteria 2954740390 2954741407 320
30 iso_pu_bacteria 2954749733 2954758158 320
31 iso_pu_bacteria 2954759201 2954760423 320
32 iso_pu_bacteria 2990059506 2990060047 320
33 iso_pu_bacteria 8008558824 8008564512 320
34 3300005841 Ga0068863_100007502 Ga0068863_1000075023 321
35 3300026088 Ga0207641_10003205 Ga0207641_1000320510 321
36 3300030521 Ga0307511_10057362 Ga0307511_100573622 321
37 3300033180 Ga0307510_10005756 Ga0307510_100057568 321
38 3300036459 Ga0372808_008671 Ga0372808_008671_340_1341 321
39 iso_pu_bacteria 2517572101 2517763190 321
40 iso_pu_bacteria 2582581313 2585303402 321
41 iso_pu_bacteria 2619618881 2619856769 321
42 iso_pu_bacteria 2643221647 2644270668 321
43 iso_pu_bacteria 2784746763 2785339571 321
44 iso_pu_bacteria 2786546132 2786674502 321
45 iso_pu_bacteria 2877676314 2877677426 321
46 iso_pu_bacteria 2954673503 2954680901 321
47 iso_pu_bacteria 2954682443 2954683256 321
48 iso_pu_bacteria 2954691527 2954692949 321
49 iso_pu_bacteria 2954701450 2954708022 321
50 iso_pu_bacteria 8056060235 8056061405 321
51 3300005334 Ga0068869_100307834 Ga0068869_1003078341 322
52 3300005842 Ga0068858_100000141 Ga0068858_10000014147 322
53 3300005842 Ga0068858_100054637 Ga0068858_1000546374 322
54 3300014968 Ga0157379_10004369 Ga0157379_1000436910 322
55 3300025900 Ga0207710_10000175 Ga0207710_1000017550 322
56 3300026035 Ga0207703_10000147 Ga0207703_1000014745 322
57 3300026035 Ga0207703_10095214 Ga0207703_100952144 322
58 3300028794 Ga0307515_10039951 Ga0307515_100399514 322
59 3300030521 Ga0307511_10034966 Ga0307511_100349661 322
60 3300042007 Ga0439449_0033384 Ga0439449_0033384_878_1855 322
61 3300045976 Ga0466967_0034224 Ga0466967_0034224_3250_4218 322
62 3300046507 Ga0495606_0098361 Ga0495606_0098361_157_1161 322
63 3300046511 Ga0495608_0127024 Ga0495608_0127024_113_1117 322
64 3300046514 Ga0495618_0054522 Ga0495618_0054522_638_1642 322
65 3300046515 Ga0495620_0019704 Ga0495620_0019704_2231_3235 322
66 3300046522 Ga0495643_0002665 Ga0495643_0002665_5580_6584 322
67 3300046524 Ga0495648_0035491 Ga0495648_0035491_1838_2842 322
68 3300046529 Ga0495652_0063204 Ga0495652_0063204_954_1958 322
69 3300046533 Ga0495640_0030899 Ga0495640_0030899_1291_2295 322
70 3300046616 Ga0495668_0089926 Ga0495668_0089926_120_1124 322
71 3300046660 Ga0495625_0166559 Ga0495625_0166559_158_1162 322
72 3300046663 Ga0495635_0051859 Ga0495635_0051859_14_1018 322
73 3300046689 Ga0495613_0039084 Ga0495613_0039084_1978_2982 322
74 3300046689 Ga0495613_0065699 Ga0495613_0065699_36_1040 322
75 3300046694 Ga0495649_0015755 Ga0495649_0015755_1887_2891 322
76 3300046794 Ga0495589_0008606 Ga0495589_0008606_3234_4238 322
77 3300047315 Ga0495581_0142857 Ga0495581_0142857_221_1225 322
78 3300047317 Ga0495604_0149269 Ga0495604_0149269_360_1364 322
79 3300047321 Ga0495676_0016442 Ga0495676_0016442_4056_5060 322
80 3300047322 Ga0495680_0060841 Ga0495680_0060841_1669_2673 322
81 3300047443 Ga0495687_076646 Ga0495687_076646_195_1199 322
82 3300047447 Ga0495685_000697 Ga0495685_000697_2041_3054 322
83 3300047447 Ga0495685_017899 Ga0495685_017899_674_1678 322
84 3300048920 Ga0496117_0084134 Ga0496117_0084134_307_1329 322
85 3300048924 Ga0496121_0007884 Ga0496121_0007884_3113_4147 322
86 3300053149 Ga0500600_0084594 Ga0500600_0084594_681_1649 322
87 iso_pu_bacteria 2579778521 2579857258 322
88 iso_pu_bacteria 2616644814 2616693277 322
89 iso_pu_bacteria 2619619003 2620353147 322
90 iso_pu_bacteria 2626541554 2626637632 322
91 iso_pu_bacteria 2671180195 2671836969 322
92 iso_pu_bacteria 2687453743 2689993604 322
93 iso_pu_bacteria 2773857922 2774855125 322
94 iso_pu_bacteria 2891554331 2891561276 322
95 iso_pu_bacteria 8047893842 8047901620 322
96 iso_pu_bacteria 8048356638 8048357272 322
97 iso_pu_bacteria 8048369669 8048378558 322
98 iso_pu_bacteria 8048379754 8048387659 322
99 iso_pu_bacteria 8054913762 8054915467 322
100 iso_pu_bacteria 8054913762 8054916192 322
101 iso_pu_bacteria 8054920844 8054925628 322
102 3300041404 Ga0439436_0012930 Ga0439436_0012930_363_1334 323
103 3300041406 Ga0439439_0005583 Ga0439439_0005583_1152_2123 323
104 3300042014 Ga0439457_010291 Ga0439457_010291_181_1152 323
105 3300005614 Ga0068856_100125514 Ga0068856_1001255143 324
106 3300025904 Ga0207647_10076985 Ga0207647_100769852 324
107 3300025910 Ga0207684_10028674 Ga0207684_100286744 324
108 3300026078 Ga0207702_10413997 Ga0207702_104139971 324
109 3300028786 Ga0307517_10068554 Ga0307517_100685542 324
110 3300028794 Ga0307515_10000325 Ga0307515_1000032542 324
111 3300030521 Ga0307511_10000010 Ga0307511_1000001052 324
112 3300031507 Ga0307509_10049084 Ga0307509_100490843 324
113 3300031507 Ga0307509_10188154 Ga0307509_101881541 324
114 3300031616 Ga0307508_10159677 Ga0307508_101596771 324
115 3300031649 Ga0307514_10185005 Ga0307514_101850051 324
116 3300031730 Ga0307516_10017287 Ga0307516_100172871 324
117 3300031730 Ga0307516_10212481 Ga0307516_102124811 324
118 3300031838 Ga0307518_10060640 Ga0307518_100606403 324
119 3300031838 Ga0307518_10148033 Ga0307518_101480332 324
120 3300033179 Ga0307507_10106170 Ga0307507_101061702 324
121 3300033180 Ga0307510_10090588 Ga0307510_100905882 324
122 3300033180 Ga0307510_10092013 Ga0307510_100920135 324
123 3300037466 Ga0395898_0014337 Ga0395898_0014337_4711_5688 324
124 3300041404 Ga0439436_0058092 Ga0439436_0058092_27_1004 324
125 3300041406 Ga0439439_0042160 Ga0439439_0042160_45_1022 324
126 3300041512 Ga0451853_0538786 Ga0451853_0538786_98_1072 324
127 3300042007 Ga0439449_0000141 Ga0439449_0000141_11102_12076 324
128 3300042014 Ga0439457_007292 Ga0439457_007292_94_1071 324
129 3300045976 Ga0466967_0183476 Ga0466967_0183476_172_1146 324
130 3300046454 Ga0495592_0021622 Ga0495592_0021622_308_1282 324
131 3300046459 Ga0495629_0104929 Ga0495629_0104929_802_1785 324
132 3300046675 Ga0495657_0025242 Ga0495657_0025242_2591_3565 324
133 3300046689 Ga0495613_0030525 Ga0495613_0030525_1695_2669 324
134 3300047322 Ga0495680_0013917 Ga0495680_0013917_3909_4883 324
135 3300047443 Ga0495687_002032 Ga0495687_002032_4770_5966 324
136 3300047444 Ga0495675_0119165 Ga0495675_0119165_444_1418 324
137 3300047470 Ga0495681_0003485 Ga0495681_0003485_3855_4838 324
138 3300048089 Ga0495614_0003166 Ga0495614_0003166_1358_2341 324
139 3300048089 Ga0495614_0061965 Ga0495614_0061965_607_1581 324
140 3300049581 Ga0501047_0155184 Ga0501047_0155184_659_1639 324
141 3300049823 Ga0501044_0001666 Ga0501044_0001666_18383_19363 324
142 3300053079 Ga0500610_0120504 Ga0500610_0120504_12_995 324
143 3300053079 Ga0500610_0184370 Ga0500610_0184370_12_995 324
144 3300053088 Ga0500644_0117995 Ga0500644_0117995_17_1003 324
145 3300053092 Ga0500583_0020099 Ga0500583_0020099_1472_2458 324
146 iso_pu_bacteria 2508501039 2508672728 324
147 3300003322 rootL2_10069511 rootL2_100695112 325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

88

291

0.94

PF20434

BD-FAE

BD-FAE

73

178

0.89

PF00135

COesterase

Carboxylesterase family

71

171

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b4q-assembly1.cif.gz_B structure of a cold active hsl family esterase reveals mechanisms of low temperature adaptation and substrate specificity 0.9478 8 325
7wol-assembly1.cif.gz_B crystal structure of lipase trlipb from thermomocrobium roseum 0.9465 8 323
7b4q-assembly1.cif.gz_B structure of a cold active hsl family esterase reveals mechanisms of low temperature adaptation and substrate specificity 0.9302 8 325
7wol-assembly1.cif.gz_A crystal structure of lipase trlipb from thermomocrobium roseum 0.9275 8 323
7wol-assembly1.cif.gz_B crystal structure of lipase trlipb from thermomocrobium roseum 0.9203 8 323
ID Description Score Start End Superfamily
af_P96399_42_298_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9156 57 325 3.40.50.1820
1lzlA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9079 8 323 3.40.50.1820
af_Q9US38_51_339_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9032 56 325 3.40.50.1820
af_Q54QI3_180_502_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8988 56 321 3.40.50.1820
4ypvA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8948 8 323 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A815M1D5-F1-model_v4 Alpha/beta hydrolase fold-3 domain-containing protein 0.9976 167 324 GO:0016787
AF-A0A2T4VII2-F1-model_v4 Lipase 0.9824 52 325 GO:0016787
AF-A0A6L7PC49-F1-model_v4 Alpha/beta hydrolase 0.9791 165 325 GO:0016787
AF-A0A229Y7V1-F1-model_v4 deleted 0.9766 54 290
AF-N1RZK9-F1-model_v4 Alpha/beta hydrolase fold-3 domain-containing protein 0.974 102 323 GO:0016787

Feature Viewer

pLDDT pTM Quality
94.77 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map