F201304

General Info

Members Datasets Scaffolds Average Seq Length
147 94 294 218

Family's Representative Sequence

Representative Sequence 3300046517|Ga0495630_0021356|Ga0495630_0021356_4045_4698
Length 212
Sequence VPKWIKTIIAILLLPVCFGAASALWMVIQKSGSADTTWVPLLAGAVCWVVIFFLLPKPMWIYVFGHELTHAVGGQVKKFKASSTGGHVVISKSNFVIALAPYFFPLYAVLVVAVFAVGQFFWSWQRLLPWLHLFLGAGYAFHVTLTWHVLKTRQSDITEQGYIFSAVIIFLGNVTVLLLGIPLLAAKVGVWTALGWWFECTGEVFHRLGKFF

Samples

Sample ID Description Type Environment
1 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
22 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
49 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
51 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
52 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
53 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
54 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
55 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
56 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
57 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
58 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
59 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
60 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
62 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
63 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
64 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
65 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
66 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
67 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
68 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
69 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
70 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
71 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
72 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
73 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
74 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
75 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
76 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
77 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
78 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
79 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
80 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
81 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
82 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
83 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
84 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
85 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
86 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
87 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
88 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
91 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
92 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
93 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
94 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.68
Rhizosphere 99.32
Stem 0
Stem Tuber 0
Unclassified 25.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495630_0021356 3300046517 Bacteria 4781
2 CNXas_1000379 3300000545 Bacteria 3491
3 Ga0070690_100348581 3300005330 Bacteria 1074
4 Ga0070691_10010185 3300005341 Unclassified 4286
5 Ga0070673_100058322 3300005364 Bacteria 3052
6 Ga0070688_100126791 3300005365 Bacteria 1717
7 Ga0070710_10102722 3300005437 Unclassified 1705
8 Ga0070705_100369674 3300005440 Bacteria 1052
9 Ga0070700_100113699 3300005441 Bacteria 1804
10 Ga0070681_10074507 3300005458 Unclassified 3356
11 Ga0070681_10631678 3300005458 Unclassified 986
12 Ga0070707_100825882 3300005468 Bacteria 891
13 Ga0070684_100353484 3300005535 Unclassified 1352
14 Ga0070686_100113757 3300005544 Bacteria 1848
15 Ga0068855_100009645 3300005563 Bacteria 11649
16 Ga0068855_100166580 3300005563 Bacteria 2498
17 Ga0068855_100746451 3300005563 Unclassified 1044
18 Ga0068857_100306444 3300005577 Bacteria 1465
19 Ga0068863_100042495 3300005841 Unclassified 4318
20 Ga0068863_100143754 3300005841 Bacteria 2281
21 Ga0068858_100594062 3300005842 Unclassified 1073
22 Ga0070712_100280374 3300006175 Bacteria 1342
23 Ga0070712_100321115 3300006175 Bacteria 1259
24 Ga0075428_100001355 3300006844 Bacteria 25992
25 Ga0075428_100084821 3300006844 Bacteria 3456
26 Ga0075434_100139351 3300006871 Bacteria 2445
27 Ga0075435_100601942 3300007076 Bacteria 953
28 Ga0099794_10068200 3300007265 Bacteria 1739
29 Ga0105240_10000765 3300009093 Bacteria 58427
30 Ga0105240_10028396 3300009093 Bacteria 7309
31 Ga0105240_10098486 3300009093 Unclassified 3561
32 Ga0105240_10459375 3300009093 Bacteria 1423
33 Ga0111539_10011794 3300009094 Bacteria 10959
34 Ga0111539_10120407 3300009094 Bacteria 3075
35 Ga0105245_10445609 3300009098 Bacteria 1302
36 Ga0105245_10668825 3300009098 Viruses 1070
37 Ga0105247_10536792 3300009101 Bacteria 858
38 Ga0105242_10180705 3300009176 Bacteria 1861
39 Ga0105238_10159544 3300009551 Bacteria 2231
40 Ga0105249_10078567 3300009553 Bacteria 3062
41 Ga0157370_10071277 3300013104 Bacteria 3278
42 Ga0157370_10179718 3300013104 Bacteria 1966
43 Ga0157374_10341445 3300013296 Bacteria 1487
44 Ga0157372_10473912 3300013307 Bacteria 1459
45 Ga0157372_10624206 3300013307 Unclassified 1256
46 Ga0157372_10645643 3300013307 Bacteria 1233
47 Ga0157372_10804312 3300013307 Unclassified 1092
48 Ga0163163_10408638 3300014325 Bacteria 1416
49 Ga0207654_10335493 3300025911 Bacteria 1037
50 Ga0207695_10023180 3300025913 Bacteria 7023
51 Ga0207695_10140238 3300025913 Bacteria 2366
52 Ga0207695_10207357 3300025913 Bacteria 1872
53 Ga0207693_10294374 3300025915 Bacteria 1272
54 Ga0207652_10111333 3300025921 Unclassified 2428
55 Ga0207694_10232034 3300025924 Unclassified 1507
56 Ga0207664_10042290 3300025929 Bacteria 3556
57 Ga0207686_10146465 3300025934 Bacteria 1639
58 Ga0207670_10004481 3300025936 Bacteria 7526
59 Ga0207670_10084239 3300025936 Bacteria 2232
60 Ga0207670_10248709 3300025936 Bacteria 1373
61 Ga0207670_10429426 3300025936 Bacteria 1062
62 Ga0207661_10200735 3300025944 Unclassified 1753
63 Ga0207667_10100149 3300025949 Bacteria 2989
64 Ga0207703_10445994 3300026035 Unclassified 1208
65 Ga0207641_10094711 3300026088 Unclassified 2619
66 Ga0207641_10448122 3300026088 Unclassified 1247
67 Ga0207641_10451088 3300026088 Bacteria 1243
68 Ga0207674_10097394 3300026116 Unclassified 2925
69 Ga0207675_100198591 3300026118 Unclassified 1926
70 Ga0207428_10154955 3300027907 Bacteria 1742
71 Ga0268265_10680597 3300028380 Unclassified 992
72 Ga0265318_10059386 3300028577 Bacteria 1426
73 Ga0265338_10003657 3300028800 Bacteria 21412
74 Ga0265338_10010572 3300028800 Bacteria 10796
75 Ga0265338_10328596 3300028800 Unclassified 1105
76 Ga0265338_10363674 3300028800 Bacteria 1037
77 Ga0265338_10611540 3300028800 Unclassified 758
78 Ga0265324_10004471 3300029957 Bacteria 6294
79 Ga0265339_10102340 3300031249 Unclassified 1489
80 Ga0265342_10105026 3300031712 Bacteria 1605
81 Ga0373954_0030500 3300035118 Bacteria 2486
82 Ga0373946_0120789 3300035171 Bacteria 1196
83 Ga0373955_0123869 3300035172 Bacteria 1504
84 Ga0373935_0028172 3300035692 Bacteria 3472
85 Ga0373947_0006990 3300035725 Bacteria 6539
86 Ga0373937_0080473 3300036401 Bacteria 3013
87 Ga0373937_0178666 3300036401 Bacteria 1993
88 Ga0373925_0004917 3300037068 Bacteria 10043
89 Ga0373925_0037132 3300037068 Bacteria 3595
90 Ga0451577_0099697 3300042876 Bacteria 2595
91 Ga0451577_0483536 3300042876 Unclassified 1124
92 Ga0453684_0000783 3300044712 Bacteria 109236
93 Ga0453684_0463767 3300044712 Bacteria 1408
94 Ga0451576_0012874 3300045051 Bacteria 9378
95 Ga0451576_0266274 3300045051 Unclassified 1791
96 Ga0451576_0365316 3300045051 Bacteria 1512
97 Ga0451576_0861155 3300045051 Unclassified 951
98 Ga0451576_1007364 3300045051 Bacteria 873
99 Ga0451576_1044747 3300045051 Unclassified 856
100 Ga0495592_0000115 3300046454 Bacteria 70181
101 Ga0495592_0059404 3300046454 Bacteria 2816
102 Ga0495641_0006168 3300046461 Bacteria 7842
103 Ga0495582_0017019 3300046473 Unclassified 3980
104 Ga0495639_0096789 3300046475 Bacteria 1390
105 Ga0495662_0001330 3300046476 Bacteria 12250
106 Ga0495618_0003385 3300046514 Bacteria 9933
107 Ga0495628_0000050 3300046516 Bacteria 93131
108 Ga0495628_0341413 3300046516 Bacteria 1102
109 Ga0495630_0000457 3300046517 Bacteria 30929
110 Ga0495630_0013265 3300046517 Bacteria 5995
111 Ga0495666_0018860 3300046526 Unclassified 3427
112 Ga0495666_0032723 3300046526 Bacteria 2544
113 Ga0495666_0102141 3300046526 Unclassified 1350
114 Ga0495652_0006167 3300046529 Bacteria 11192
115 Ga0495652_0066406 3300046529 Bacteria 3028
116 Ga0495640_0099930 3300046533 Bacteria 1905
117 Ga0495640_0100504 3300046533 Unclassified 1899
118 Ga0495586_0000251 3300046535 Bacteria 35230
119 Ga0495586_0000299 3300046535 Bacteria 31466
120 Ga0495586_0125725 3300046535 Unclassified 1434
121 Ga0495645_0102882 3300046543 Bacteria 2029
122 Ga0495645_0148777 3300046543 Bacteria 1629
123 Ga0495645_0188165 3300046543 Bacteria 1409
124 Ga0495634_0093477 3300046642 Unclassified 1950
125 Ga0495634_0264411 3300046642 Unclassified 1048
126 Ga0495599_0001540 3300046678 Bacteria 13270
127 Ga0495647_0022006 3300046681 Unclassified 2301
128 Ga0495647_0097124 3300046681 Unclassified 1215
129 Ga0495658_0002181 3300046683 Bacteria 9901
130 Ga0495613_0018331 3300046689 Bacteria 5220
131 Ga0495624_0030912 3300046690 Bacteria 3486
132 Ga0495674_0005756 3300047319 Bacteria 11884
133 Ga0495674_0017967 3300047319 Bacteria 6583
134 Ga0495674_0054989 3300047319 Bacteria 3492
135 Ga0495676_0007701 3300047321 Bacteria 9878
136 Ga0495675_0197145 3300047444 Bacteria 1227
137 Ga0495684_0081055 3300047471 Bacteria 2463
138 Ga0495684_0123253 3300047471 Bacteria 1951
139 Ga0496115_0177288 3300048918 Bacteria 1762
140 Ga0501036_0442945 3300049572 Unclassified 1082
141 Ga0501043_0163563 3300049579 Bacteria 1738
142 Ga0501047_0071684 3300049581 Bacteria 3335
143 nmdc:mga06r32_199562_c1 3300050510 Bacteria 1988
144 nmdc:mga08y16_28828_c1 3300050511 Bacteria 5851
145 nmdc:mga08y16_401263_c1 3300050511 Unclassified 1403
146 nmdc:mga0rr50_682736_c1 3300050513 Bacteria 876
147 Ga0495601_0045362 3300053077 Bacteria 2764
148 Ga0495630_0021356
149 CNXas_1000379
150 Ga0070690_100348581
151 Ga0070691_10010185
152 Ga0070673_100058322
153 Ga0070688_100126791
154 Ga0070710_10102722
155 Ga0070705_100369674
156 Ga0070700_100113699
157 Ga0070681_10074507
158 Ga0070681_10631678
159 Ga0070707_100825882
160 Ga0070684_100353484
161 Ga0070686_100113757
162 Ga0068855_100009645
163 Ga0068855_100166580
164 Ga0068855_100746451
165 Ga0068857_100306444
166 Ga0068863_100042495
167 Ga0068863_100143754
168 Ga0068858_100594062
169 Ga0070712_100280374
170 Ga0070712_100321115
171 Ga0075428_100001355
172 Ga0075428_100084821
173 Ga0075434_100139351
174 Ga0075435_100601942
175 Ga0099794_10068200
176 Ga0105240_10000765
177 Ga0105240_10028396
178 Ga0105240_10098486
179 Ga0105240_10459375
180 Ga0111539_10011794
181 Ga0111539_10120407
182 Ga0105245_10445609
183 Ga0105245_10668825
184 Ga0105247_10536792
185 Ga0105242_10180705
186 Ga0105238_10159544
187 Ga0105249_10078567
188 Ga0157370_10071277
189 Ga0157370_10179718
190 Ga0157374_10341445
191 Ga0157372_10473912
192 Ga0157372_10624206
193 Ga0157372_10645643
194 Ga0157372_10804312
195 Ga0163163_10408638
196 Ga0207654_10335493
197 Ga0207695_10023180
198 Ga0207695_10140238
199 Ga0207695_10207357
200 Ga0207693_10294374
201 Ga0207652_10111333
202 Ga0207694_10232034
203 Ga0207664_10042290
204 Ga0207686_10146465
205 Ga0207670_10004481
206 Ga0207670_10084239
207 Ga0207670_10248709
208 Ga0207670_10429426
209 Ga0207661_10200735
210 Ga0207667_10100149
211 Ga0207703_10445994
212 Ga0207641_10094711
213 Ga0207641_10448122
214 Ga0207641_10451088
215 Ga0207674_10097394
216 Ga0207675_100198591
217 Ga0207428_10154955
218 Ga0268265_10680597
219 Ga0265318_10059386
220 Ga0265338_10003657
221 Ga0265338_10010572
222 Ga0265338_10328596
223 Ga0265338_10363674
224 Ga0265338_10611540
225 Ga0265324_10004471
226 Ga0265339_10102340
227 Ga0265342_10105026
228 Ga0373954_0030500
229 Ga0373946_0120789
230 Ga0373955_0123869
231 Ga0373935_0028172
232 Ga0373947_0006990
233 Ga0373937_0080473
234 Ga0373937_0178666
235 Ga0373925_0004917
236 Ga0373925_0037132
237 Ga0451577_0099697
238 Ga0451577_0483536
239 Ga0453684_0000783
240 Ga0453684_0463767
241 Ga0451576_0012874
242 Ga0451576_0266274
243 Ga0451576_0365316
244 Ga0451576_0861155
245 Ga0451576_1007364
246 Ga0451576_1044747
247 Ga0495592_0000115
248 Ga0495592_0059404
249 Ga0495641_0006168
250 Ga0495582_0017019
251 Ga0495639_0096789
252 Ga0495662_0001330
253 Ga0495618_0003385
254 Ga0495628_0000050
255 Ga0495628_0341413
256 Ga0495630_0000457
257 Ga0495630_0013265
258 Ga0495666_0018860
259 Ga0495666_0032723
260 Ga0495666_0102141
261 Ga0495652_0006167
262 Ga0495652_0066406
263 Ga0495640_0099930
264 Ga0495640_0100504
265 Ga0495586_0000251
266 Ga0495586_0000299
267 Ga0495586_0125725
268 Ga0495645_0102882
269 Ga0495645_0148777
270 Ga0495645_0188165
271 Ga0495634_0093477
272 Ga0495634_0264411
273 Ga0495599_0001540
274 Ga0495647_0022006
275 Ga0495647_0097124
276 Ga0495658_0002181
277 Ga0495613_0018331
278 Ga0495624_0030912
279 Ga0495674_0005756
280 Ga0495674_0017967
281 Ga0495674_0054989
282 Ga0495676_0007701
283 Ga0495675_0197145
284 Ga0495684_0081055
285 Ga0495684_0123253
286 Ga0496115_0177288
287 Ga0501036_0442945
288 Ga0501043_0163563
289 Ga0501047_0071684
290 nmdc:mga06r32_199562_c1
291 nmdc:mga08y16_28828_c1
292 nmdc:mga08y16_401263_c1
293 nmdc:mga0rr50_682736_c1
294 Ga0495601_0045362

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lds-assembly1.cif.gz_A the inward-facing structure of the glucose transporter from staphylococcus epidermidis 0.3893 12 210
7aar-assembly1.cif.gz_A sugar/h+ symporter stp10 in inward open conformation 0.3803 99 213
6qk0-assembly1.cif.gz_B r2-like ligand-binding oxidase e69d mutant with anaerobically reconstituted mn/fe cofactor 0.3671 95 208
8e8w-assembly1.cif.gz_A crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 mononuclear fe(ii) structure on the hdo cofactor assembly pathway 0.3657 99 190
8j80-assembly1.cif.gz_A cryo-em structure of hznt7-fab complex in zinc state 1, determined in heterogeneous conformations- one subunit in an inward-facing zinc-bound and the other in an outward-facing zinc-unbound conformation 0.3375 36 199
ID Description Score Start End Superfamily
af_Q54FQ9_203_510_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.4265 96 185 1.20.1080.10
af_A4HSA9_3_252_1.20.1110.10 Mainly Alpha;Up-down Bundle;Calcium-transporting ATPase, transmembrane domain;Calcium-transporting ATPase, transmembrane domain 0.4256 91 155 1.20.1110.10
af_A4HSA9_34_217_2.70.150.10 Mainly Beta;Distorted Sandwich;Calcium-transporting ATPase, cytoplasmic transduction domain A;Calcium-transporting ATPase, cytoplasmic transduction domain A 0.4256 91 155 2.70.150.10
af_A0A1D8PF32_71_260_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.4133 95 211 1.20.120.1760
af_Q2G2B3_4_390_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3917 10 208 1.20.1250.20
ID Description Score Start End GO Terms
AF-B9XEC5-F1-model_v4 Peptidase M50 0.9815 1 216 GO:0016020
AF-A0A7V4IHJ5-F1-model_v4 M50 family peptidase 0.98 3 216 GO:0016020
AF-A0A1V6GEH0-F1-model_v4 deleted 0.977 1 216
AF-B9XEC5-F1-model_v4 Peptidase M50 0.977 1 216 GO:0016020
AF-A0A3C1VEW8-F1-model_v4 DUF3267 domain-containing protein 0.9768 1 216 GO:0016020

Map