F200804

General Info

Members Datasets Scaffolds Average Seq Length
147 108 294 146

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100512170|Ga0307408_1005121702
Length 167
Sequence MNNQPIVLEKTFNAPVRRVWQAITDKDEMKKWYFDLAEFKAEKGFQFQFTGGKEGGKQFLHLCEVTEVVPQKKLTYSWRYDGFAGNSFVTFELFEQEDKTLLRLTHQGLETFPSETSDFARENFVEGWNHIINISLKEYLETGQIADEAATSEQDRAVPDKAAAQAE

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
89 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
93 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
94 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
95 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
96 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
97 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
98 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
99 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
102 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
103 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
104 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
105 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
106 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
107 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
108 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.12
Nodule 0
Rhizoplane 1.36
Rhizosphere 89.8
Stem 0
Stem Tuber 0
Unclassified 20.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100512170 3300031548 Unclassified 1052
2 JGI24739J22299_10025191 3300001989 Bacteria 2092
3 JGI25153J46596_10100186 3300003215 Unclassified 683
4 rootH2_10017148 3300003320 Bacteria 6302
5 rootH2_10240774 3300003320 Bacteria 1181
6 rootH1_10198589 3300003323 Unclassified 2606
7 Ga0065712_10176292 3300005290 Bacteria 1127
8 Ga0065715_10241538 3300005293 Bacteria 1197
9 Ga0070658_10056781 3300005327 Bacteria 3183
10 Ga0070658_10425936 3300005327 Bacteria 1142
11 Ga0070676_10093729 3300005328 Bacteria 1844
12 Ga0070668_100226825 3300005347 Bacteria 1543
13 Ga0070674_100327195 3300005356 Unclassified 1231
14 Ga0070667_100682225 3300005367 Bacteria 950
15 Ga0070713_100185028 3300005436 Unclassified 1874
16 Ga0070711_100397630 3300005439 Unclassified 1118
17 Ga0070705_100122478 3300005440 Bacteria 1682
18 Ga0070700_100683129 3300005441 Bacteria 814
19 Ga0070708_100128885 3300005445 Bacteria 2341
20 Ga0070708_100295333 3300005445 Unclassified 1526
21 Ga0070708_100686373 3300005445 Bacteria 964
22 Ga0070678_100216957 3300005456 Bacteria 1588
23 Ga0070662_100170449 3300005457 Bacteria 1709
24 Ga0070706_100040766 3300005467 Bacteria 4286
25 Ga0070706_100070648 3300005467 Bacteria 3229
26 Ga0070706_100104454 3300005467 Bacteria 2635
27 Ga0070707_100194080 3300005468 Bacteria 1980
28 Ga0070707_100675615 3300005468 Unclassified 995
29 Ga0070698_100167385 3300005471 Unclassified 2140
30 Ga0070699_100267421 3300005518 Unclassified 1530
31 Ga0070699_100517944 3300005518 Bacteria 1084
32 Ga0070679_100000732 3300005530 Bacteria 28381
33 Ga0070697_100059426 3300005536 Bacteria 3113
34 Ga0070697_100079389 3300005536 Bacteria 2701
35 Ga0068853_100019191 3300005539 Bacteria 5666
36 Ga0068853_100091922 3300005539 Bacteria 2669
37 Ga0070672_100377012 3300005543 Bacteria 1213
38 Ga0070665_100000442 3300005548 Bacteria 60619
39 Ga0068855_100369420 3300005563 Bacteria 1577
40 Ga0068855_100839338 3300005563 Bacteria 974
41 Ga0068856_100789494 3300005614 Bacteria 969
42 Ga0070702_100171976 3300005615 Unclassified 1410
43 Ga0081539_10007297 3300005985 Bacteria 10147
44 Ga0070717_10002775 3300006028 Bacteria 12392
45 Ga0070717_10130624 3300006028 Bacteria 2160
46 Ga0070712_100136376 3300006175 Bacteria 1866
47 Ga0075362_10127867 3300006177 Bacteria 1207
48 Ga0097621_100010912 3300006237 Bacteria 6670
49 Ga0097621_100157023 3300006237 Bacteria 1953
50 Ga0075370_10465542 3300006353 Bacteria 761
51 Ga0068871_100024914 3300006358 Bacteria 4646
52 Ga0075428_100442803 3300006844 Unclassified 1392
53 Ga0068865_100821489 3300006881 Bacteria 803
54 Ga0105240_10000193 3300009093 Bacteria 124087
55 Ga0111539_10043403 3300009094 Bacteria 5390
56 Ga0111539_10650334 3300009094 Unclassified 1228
57 Ga0105237_10005037 3300009545 Bacteria 15043
58 Ga0105237_10256954 3300009545 Bacteria 1749
59 Ga0105237_10903012 3300009545 Bacteria 890
60 Ga0105238_10094032 3300009551 Bacteria 2985
61 Ga0105238_10182962 3300009551 Bacteria 2072
62 Ga0105239_10007004 3300010375 Bacteria 12974
63 Ga0105239_10114630 3300010375 Bacteria 2989
64 Ga0157371_10857778 3300013102 Unclassified 687
65 Ga0157371_11184343 3300013102 Unclassified 588
66 Ga0157370_10142112 3300013104 Unclassified 2236
67 Ga0157369_10000710 3300013105 Bacteria 42913
68 Ga0157374_10016851 3300013296 Bacteria 6429
69 Ga0157374_10531930 3300013296 Unclassified 1182
70 Ga0157378_10017490 3300013297 Bacteria 6293
71 Ga0157378_10120282 3300013297 Bacteria 2420
72 Ga0163162_10067888 3300013306 Bacteria 3616
73 Ga0163162_10087927 3300013306 Bacteria 3187
74 Ga0163162_10207132 3300013306 Bacteria 2090
75 Ga0157372_10000010 3300013307 Bacteria 300658
76 Ga0157372_10191083 3300013307 Unclassified 2372
77 Ga0157372_10217248 3300013307 Bacteria 2216
78 Ga0157372_10323322 3300013307 Unclassified 1796
79 Ga0157375_10088980 3300013308 Bacteria 3143
80 Ga0157375_10115441 3300013308 Bacteria 2788
81 Ga0157375_11028353 3300013308 Bacteria 962
82 Ga0157375_11086175 3300013308 Bacteria 936
83 Ga0157379_10058238 3300014968 Bacteria 3454
84 Ga0157376_10623302 3300014969 Bacteria 1076
85 Ga0163161_10187250 3300017792 Bacteria 1589
86 Ga0163161_10698057 3300017792 Bacteria 845
87 Ga0207697_10154860 3300025315 Bacteria 998
88 Ga0207680_10047628 3300025903 Bacteria 2541
89 Ga0207647_10004321 3300025904 Bacteria 10533
90 Ga0207645_10019644 3300025907 Bacteria 4428
91 Ga0207705_10137144 3300025909 Unclassified 1825
92 Ga0207705_10621216 3300025909 Bacteria 840
93 Ga0207684_10027753 3300025910 Bacteria 4822
94 Ga0207684_10050035 3300025910 Bacteria 3545
95 Ga0207684_10084635 3300025910 Bacteria 2701
96 Ga0207684_10152867 3300025910 Bacteria 1986
97 Ga0207654_10119968 3300025911 Bacteria 1650
98 Ga0207695_10000013 3300025913 Bacteria 821265
99 Ga0207695_10014224 3300025913 Bacteria 9439
100 Ga0207671_10003540 3300025914 Bacteria 15488
101 Ga0207693_10120458 3300025915 Unclassified 2061
102 Ga0207652_10000010 3300025921 Bacteria 247079
103 Ga0207646_10002931 3300025922 Bacteria 19783
104 Ga0207646_10293628 3300025922 Unclassified 1469
105 Ga0207694_10070338 3300025924 Bacteria 2734
106 Ga0207694_10207639 3300025924 Bacteria 1595
107 Ga0207700_10549668 3300025928 Bacteria 1025
108 Ga0207706_10136430 3300025933 Bacteria 2158
109 Ga0207691_10431367 3300025940 Bacteria 1122
110 Ga0207667_10975333 3300025949 Bacteria 836
111 Ga0207668_10225342 3300025972 Bacteria 1508
112 Ga0207658_10717283 3300025986 Bacteria 904
113 Ga0207639_10013759 3300026041 Bacteria 5673
114 Ga0207678_10059885 3300026067 Unclassified 3276
115 Ga0207702_10718654 3300026078 Bacteria 985
116 Ga0207648_10075527 3300026089 Bacteria 2938
117 Ga0207683_10358093 3300026121 Bacteria 1340
118 Ga0268266_10000845 3300028379 Bacteria 39924
119 Ga0265337_1072577 3300028556 Unclassified 945
120 Ga0265338_10010630 3300028800 Bacteria 10754
121 Ga0307509_10041243 3300031507 Bacteria 5010
122 Ga0395899_0000576 3300037312 Bacteria 38965
123 Ga0395900_0756899 3300037418 Bacteria 901
124 Ga0395905_0101047 3300037471 Bacteria 2708
125 Ga0451807_0464848 3300041486 Unclassified 584
126 Ga0439431_0256919 3300041997 Unclassified 519
127 Ga0466966_0132525 3300044684 Bacteria 1525
128 Ga0466961_0052516 3300044693 Unclassified 2601
129 Ga0453684_0023004 3300044712 Bacteria 9213
130 Ga0453684_0216425 3300044712 Bacteria 2222
131 Ga0466971_0649744 3300044719 Unclassified 528
132 Ga0466959_0053612 3300045049 Bacteria 2948
133 Ga0495668_0156897 3300046616 Bacteria 1246
134 Ga0495625_0121093 3300046660 Bacteria 1780
135 Ga0495672_0058143 3300047320 Bacteria 2243
136 Ga0495679_207913 3300047446 Bacteria 513
137 Ga0495686_0028019 3300047472 Bacteria 3672
138 Ga0495686_0585777 3300047472 Bacteria 579
139 Ga0496109_0167653 3300048912 Bacteria 2060
140 nmdc:mga07m45_432051_c1 3300050496 Bacteria 764
141 nmdc:mga08y16_93164_c1 3300050511 Bacteria 3139
142 nmdc:mga0a205_1078328_c1 3300050515 Bacteria 650
143 Ga0500650_0122805 3300053098 Bacteria 1210
144 Ga0500594_0212770 3300053118 Unclassified 637
145 Ga0500642_0013599 3300053130 Bacteria 2998
146 Ga0500588_0266264 3300053146 Unclassified 645
147 Ga0500611_000023 3300053727 Bacteria 102347
148 Ga0307408_100512170
149 JGI24739J22299_10025191
150 JGI25153J46596_10100186
151 rootH2_10017148
152 rootH2_10240774
153 rootH1_10198589
154 Ga0065712_10176292
155 Ga0065715_10241538
156 Ga0070658_10056781
157 Ga0070658_10425936
158 Ga0070676_10093729
159 Ga0070668_100226825
160 Ga0070674_100327195
161 Ga0070667_100682225
162 Ga0070713_100185028
163 Ga0070711_100397630
164 Ga0070705_100122478
165 Ga0070700_100683129
166 Ga0070708_100128885
167 Ga0070708_100295333
168 Ga0070708_100686373
169 Ga0070678_100216957
170 Ga0070662_100170449
171 Ga0070706_100040766
172 Ga0070706_100070648
173 Ga0070706_100104454
174 Ga0070707_100194080
175 Ga0070707_100675615
176 Ga0070698_100167385
177 Ga0070699_100267421
178 Ga0070699_100517944
179 Ga0070679_100000732
180 Ga0070697_100059426
181 Ga0070697_100079389
182 Ga0068853_100019191
183 Ga0068853_100091922
184 Ga0070672_100377012
185 Ga0070665_100000442
186 Ga0068855_100369420
187 Ga0068855_100839338
188 Ga0068856_100789494
189 Ga0070702_100171976
190 Ga0081539_10007297
191 Ga0070717_10002775
192 Ga0070717_10130624
193 Ga0070712_100136376
194 Ga0075362_10127867
195 Ga0097621_100010912
196 Ga0097621_100157023
197 Ga0075370_10465542
198 Ga0068871_100024914
199 Ga0075428_100442803
200 Ga0068865_100821489
201 Ga0105240_10000193
202 Ga0111539_10043403
203 Ga0111539_10650334
204 Ga0105237_10005037
205 Ga0105237_10256954
206 Ga0105237_10903012
207 Ga0105238_10094032
208 Ga0105238_10182962
209 Ga0105239_10007004
210 Ga0105239_10114630
211 Ga0157371_10857778
212 Ga0157371_11184343
213 Ga0157370_10142112
214 Ga0157369_10000710
215 Ga0157374_10016851
216 Ga0157374_10531930
217 Ga0157378_10017490
218 Ga0157378_10120282
219 Ga0163162_10067888
220 Ga0163162_10087927
221 Ga0163162_10207132
222 Ga0157372_10000010
223 Ga0157372_10191083
224 Ga0157372_10217248
225 Ga0157372_10323322
226 Ga0157375_10088980
227 Ga0157375_10115441
228 Ga0157375_11028353
229 Ga0157375_11086175
230 Ga0157379_10058238
231 Ga0157376_10623302
232 Ga0163161_10187250
233 Ga0163161_10698057
234 Ga0207697_10154860
235 Ga0207680_10047628
236 Ga0207647_10004321
237 Ga0207645_10019644
238 Ga0207705_10137144
239 Ga0207705_10621216
240 Ga0207684_10027753
241 Ga0207684_10050035
242 Ga0207684_10084635
243 Ga0207684_10152867
244 Ga0207654_10119968
245 Ga0207695_10000013
246 Ga0207695_10014224
247 Ga0207671_10003540
248 Ga0207693_10120458
249 Ga0207652_10000010
250 Ga0207646_10002931
251 Ga0207646_10293628
252 Ga0207694_10070338
253 Ga0207694_10207639
254 Ga0207700_10549668
255 Ga0207706_10136430
256 Ga0207691_10431367
257 Ga0207667_10975333
258 Ga0207668_10225342
259 Ga0207658_10717283
260 Ga0207639_10013759
261 Ga0207678_10059885
262 Ga0207702_10718654
263 Ga0207648_10075527
264 Ga0207683_10358093
265 Ga0268266_10000845
266 Ga0265337_1072577
267 Ga0265338_10010630
268 Ga0307509_10041243
269 Ga0395899_0000576
270 Ga0395900_0756899
271 Ga0395905_0101047
272 Ga0451807_0464848
273 Ga0439431_0256919
274 Ga0466966_0132525
275 Ga0466961_0052516
276 Ga0453684_0023004
277 Ga0453684_0216425
278 Ga0466971_0649744
279 Ga0466959_0053612
280 Ga0495668_0156897
281 Ga0495625_0121093
282 Ga0495672_0058143
283 Ga0495679_207913
284 Ga0495686_0028019
285 Ga0495686_0585777
286 Ga0496109_0167653
287 nmdc:mga07m45_432051_c1
288 nmdc:mga08y16_93164_c1
289 nmdc:mga0a205_1078328_c1
290 Ga0500650_0122805
291 Ga0500594_0212770
292 Ga0500642_0013599
293 Ga0500588_0266264
294 Ga0500611_000023

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

13

141

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fpw-assembly3.cif.gz_A crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.8858 5 140
2luz-assembly1.cif.gz_A solution nmr structure of calu16 from micromonospora echinospora, northeast structural genomics consortium (nesg) target mir12 0.8812 5 141
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.8648 4 140
3rd6-assembly2.cif.gz_A crystal structure of mll3558 protein from rhizobium loti. northeast structural genomics consortium target id mlr403 0.8561 5 139
4fpw-assembly3.cif.gz_B crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.8451 5 144
ID Description Score Start End Superfamily
2luzA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8812 5 141 3.30.530.20
af_Q9V9Q4_218_347_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8361 5 142 3.30.530.20
4fpwA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8344 5 140 3.30.530.20
3q64A00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8254 5 140 3.30.530.20
af_Q9V9Q4_218_347_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8128 5 142 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A840TX59-F1-model_v4 Uncharacterized protein YndB with AHSA1/START domain 0.9984 1 140
AF-A0A5B6TDB6-F1-model_v4 SRPBCC domain-containing protein 0.9955 1 140
AF-A0A1G9HHH1-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.9938 4 140
AF-A0A2V5TTW4-F1-model_v4 SRPBCC domain-containing protein 0.9898 18 140
AF-A0A2S7SUL8-F1-model_v4 SRPBCC domain-containing protein 0.987 1 140

Map