F200159

General Info

Members Datasets Scaffolds Average Seq Length
147 122 99 275

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10007057|Ga0105244_100070576
Length 299
Sequence MEPFVLNKNVMKDIEEKTYHGDQDPLLLYIEPWKRLFERLTVGFTTRHGGVGQEPYATLNCAYHVGDDAEAVLRNRRLLTEKLAFPLEAWTCGEQVHGKAVAVITAKDKGRGLLDRQSALQDTDGLVTNVPGVLLTSFYADCVPLYFYDPVNQAVGLAHAGWKGTVAGIAVSMVETMEREYGSRREDIRAAIGPSIGDCCYEVDEAVMQHVRVWLNEPQGNDEYKHSASKRIYTPVANGKTMLNLKECNRHIMMKAGILPDHIECTTWCTSCHPELFFSYRKENGVTGRMASWIGLEER

Samples

Sample ID Description Type Environment
1 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
2 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
3 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
4 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
5 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
6 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
7 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
8 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
9 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
10 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
11 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
12 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
13 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
14 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
15 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
16 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
17 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
18 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
19 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
20 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
21 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
22 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
23 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
24 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
25 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
26 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
27 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
28 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
29 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
30 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
31 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
32 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
33 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
34 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
35 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
36 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
37 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
38 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
39 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
40 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
41 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
42 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
43 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
44 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
45 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
46 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
47 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
48 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
61 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
64 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
73 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
74 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
75 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
76 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
77 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
78 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
79 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
84 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
85 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
86 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
88 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
91 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
92 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
93 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
94 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
100 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
101 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
105 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
106 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
107 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
108 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
109 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
110 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
111 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
112 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
113 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
114 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
117 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
118 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
119 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
120 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
121 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
122 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 67.35
Metatranscriptomes 0
Isolates 32.65

Biome Distribution

Category Percentage (%)
Aerial Root 1.36
Bulb 0
Endosphere 3.4
Nodule 0.68
Rhizoplane 2.04
Rhizosphere 63.95
Stem 0
Stem Tuber 0
Unclassified 28.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055538_1000091 3300003751 Bacteria 77577
2 Ga0070680_100090292 3300005336 Bacteria 2536
3 Ga0070688_100095029 3300005365 Unclassified 1955
4 Ga0070681_10014285 3300005458 Bacteria 7901
5 Ga0070681_10022179 3300005458 Bacteria 6373
6 Ga0070679_100008594 3300005530 Bacteria 9626
7 Ga0070679_100027855 3300005530 Bacteria 5567
8 Ga0070679_100034693 3300005530 Bacteria 5001
9 Ga0070672_100681871 3300005543 Bacteria 899
10 Ga0105244_10007057 3300009036 Bacteria 7185
11 Ga0105244_10052980 3300009036 Bacteria 2064
12 Ga0105242_10202733 3300009176 Unclassified 1763
13 Ga0105246_10066725 3300011119 Bacteria 2520
14 Ga0157371_10080328 3300013102 Bacteria 2309
15 Ga0157372_10056778 3300013307 Bacteria 4374
16 Ga0163163_10049240 3300014325 Bacteria 4146
17 Ga0213875_10000028 3300021388 Bacteria 187813
18 Ga0224572_1002498 3300024225 Bacteria 2981
19 Ga0209784_100135 3300025224 Bacteria 70506
20 Ga0209147_100057 3300025229 Bacteria 253870
21 Ga0209437_100793 3300025233 Bacteria 14677
22 Ga0209675_1029963 3300025291 Bacteria 1304
23 Ga0207655_1010240 3300025728 Bacteria 5706
24 Ga0207705_10170376 3300025909 Bacteria 1639
25 Ga0207707_10182345 3300025912 Bacteria 1833
26 Ga0207660_10079387 3300025917 Bacteria 2407
27 Ga0207652_10027053 3300025921 Bacteria 4779
28 Ga0207652_10079972 3300025921 Bacteria 2857
29 Ga0207652_10099632 3300025921 Bacteria 2564
30 Ga0207648_10072725 3300026089 Unclassified 2996
31 Ga0207674_10019720 3300026116 Bacteria 7299
32 Ga0265337_1020589 3300028556 Bacteria 2065
33 Ga0265330_10002816 3300031235 Bacteria 9319
34 Ga0265330_10009034 3300031235 Bacteria 4752
35 Ga0265332_10009415 3300031238 Bacteria 4360
36 Ga0265328_10092841 3300031239 Bacteria 1115
37 Ga0265325_10006810 3300031241 Bacteria 6909
38 Ga0265340_10002699 3300031247 Bacteria 10092
39 Ga0265339_10019274 3300031249 Bacteria 4009
40 Ga0265331_10001680 3300031250 Bacteria 15997
41 Ga0265316_10000442 3300031344 Bacteria 47118
42 Ga0265313_10039592 3300031595 Bacteria 2337
43 Ga0265314_10000150 3300031711 Bacteria 104182
44 Ga0265342_10000703 3300031712 Bacteria 34958
45 Ga0316578_10187547 3300031728 Bacteria 1246
46 Ga0373943_0156628 3300035170 Unclassified 1237
47 Ga0373935_0050324 3300035692 Bacteria 2644
48 Ga0373933_0063623 3300035724 Bacteria 2231
49 Ga0316584_0207299 3300036712 Bacteria 1444
50 Ga0395905_0032358 3300037471 Bacteria 4919
51 Ga0436364_0302973 3300037853 Bacteria 187060
52 Ga0439436_0042249 3300041404 Bacteria 1303
53 Ga0439433_0000516 3300041999 Bacteria 7247
54 Ga0439462_0000505 3300042015 Bacteria 7685
55 Ga0466969_0084123 3300044656 Bacteria 1514
56 Ga0466959_0018970 3300045049 Bacteria 5054
57 Ga0466967_0247882 3300045976 Bacteria 1701
58 Ga0466967_0449903 3300045976 Bacteria 1259
59 Ga0495627_032968 3300046453 Bacteria 1627
60 Ga0495651_0426544 3300046462 Bacteria 861
61 Ga0495599_0053265 3300046678 Bacteria 2535
62 Ga0495646_0129264 3300046680 Bacteria 1423
63 Ga0495686_0000030 3300047472 Bacteria 365121
64 Ga0495686_0004114 3300047472 Bacteria 12111
65 Ga0495686_0041586 3300047472 Bacteria 2926
66 Ga0495686_0072242 3300047472 Bacteria 2122
67 Ga0496104_0000074 3300048907 Bacteria 103117
68 Ga0496109_0679447 3300048912 Bacteria 967
69 Ga0496116_0004229 3300048919 Bacteria 13795
70 Ga0496116_0005198 3300048919 Bacteria 12202
71 Ga0496116_0019761 3300048919 Bacteria 5146
72 Ga0496117_0014565 3300048920 Bacteria 6767
73 Ga0496118_0032540 3300048921 Bacteria 4292
74 Ga0496119_0004713 3300048922 Bacteria 13415
75 Ga0496120_0000215 3300048923 Bacteria 99455
76 Ga0496121_0085844 3300048924 Bacteria 2476
77 Ga0496121_0120085 3300048924 Bacteria 1986
78 Ga0496122_0000500 3300048925 Bacteria 81587
79 Ga0496122_0023471 3300048925 Bacteria 5436
80 Ga0496122_0058148 3300048925 Bacteria 2865
81 Ga0496122_0077867 3300048925 Bacteria 2325
82 Ga0496123_0039047 3300048926 Bacteria 3326
83 Ga0496123_0068861 3300048926 Bacteria 2226
84 Ga0496124_0001252 3300048927 Bacteria 38851
85 Ga0496124_0151530 3300048927 Bacteria 1818
86 Ga0496125_0001763 3300048928 Bacteria 30006
87 Ga0496125_0121806 3300048928 Bacteria 1858
88 Ga0496126_0000536 3300048929 Bacteria 73415
89 Ga0496126_0001591 3300048929 Bacteria 34591
90 Ga0496126_0002005 3300048929 Bacteria 28810
91 Ga0496126_0008493 3300048929 Bacteria 11067
92 Ga0501038_0364152 3300049574 Unclassified 1124
93 Ga0501076_0105357 3300049592 Bacteria 2276
94 Ga0501081_0139192 3300049743 Bacteria 1739
95 Ga0501045_0474819 3300049824 Unclassified 929
96 Ga0501084_0210692 3300054114 Bacteria 1640
97 Ga0530510_0013186 3300061734 Bacteria 5813
98 Ga0530510_0025185 3300061734 Bacteria 4253
99 Ga0530510_0439388 3300061734 Bacteria 986

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046462 Ga0495651_0426544 Ga0495651_0426544_12_773 239
2 3300035170 Ga0373943_0156628 Ga0373943_0156628_357_1085 242
3 3300035692 Ga0373935_0050324 Ga0373935_0050324_731_1459 242
4 3300035724 Ga0373933_0063623 Ga0373933_0063623_341_1069 242
5 3300049743 Ga0501081_0139192 Ga0501081_0139192_117_863 242
6 3300049824 Ga0501045_0474819 Ga0501045_0474819_153_902 243
7 3300054114 Ga0501084_0210692 Ga0501084_0210692_139_888 243
8 3300061734 Ga0530510_0013186 Ga0530510_0013186_4464_5213 243
9 iso_pu_bacteria 2888578766 2888580961 245
10 3300061734 Ga0530510_0439388 Ga0530510_0439388_115_930 247
11 3300005530 Ga0070679_100034693 Ga0070679_1000346934 248
12 3300013102 Ga0157371_10080328 Ga0157371_100803282 248
13 3300013307 Ga0157372_10056778 Ga0157372_100567782 248
14 3300014325 Ga0163163_10049240 Ga0163163_100492402 248
15 3300025909 Ga0207705_10170376 Ga0207705_101703762 248
16 3300025921 Ga0207652_10079972 Ga0207652_100799722 248
17 3300049592 Ga0501076_0105357 Ga0501076_0105357_749_1567 248
18 3300005336 Ga0070680_100090292 Ga0070680_1000902923 250
19 3300005458 Ga0070681_10014285 Ga0070681_100142858 250
20 3300005458 Ga0070681_10022179 Ga0070681_100221798 250
21 3300005530 Ga0070679_100008594 Ga0070679_1000085946 250
22 3300005530 Ga0070679_100027855 Ga0070679_1000278557 250
23 3300005543 Ga0070672_100681871 Ga0070672_1006818711 250
24 3300025912 Ga0207707_10182345 Ga0207707_101823452 250
25 3300025917 Ga0207660_10079387 Ga0207660_100793873 250
26 3300025921 Ga0207652_10027053 Ga0207652_100270531 250
27 3300025921 Ga0207652_10099632 Ga0207652_100996324 250
28 3300045976 Ga0466967_0247882 Ga0466967_0247882_402_1154 250
29 3300046678 Ga0495599_0053265 Ga0495599_0053265_1216_1974 250
30 3300046680 Ga0495646_0129264 Ga0495646_0129264_198_956 250
31 3300047472 Ga0495686_0072242 Ga0495686_0072242_575_1390 250
32 3300048912 Ga0496109_0679447 Ga0496109_0679447_62_829 250
33 3300049574 Ga0501038_0364152 Ga0501038_0364152_68_838 254
34 3300037471 Ga0395905_0032358 Ga0395905_0032358_3957_4730 255
35 3300028556 Ga0265337_1020589 Ga0265337_10205892 258
36 3300031235 Ga0265330_10009034 Ga0265330_100090343 258
37 3300031238 Ga0265332_10009415 Ga0265332_100094153 258
38 3300031239 Ga0265328_10092841 Ga0265328_100928412 258
39 3300031241 Ga0265325_10006810 Ga0265325_100068103 258
40 3300031247 Ga0265340_10002699 Ga0265340_100026995 258
41 3300031249 Ga0265339_10019274 Ga0265339_100192742 258
42 3300031250 Ga0265331_10001680 Ga0265331_1000168013 258
43 3300031595 Ga0265313_10039592 Ga0265313_100395922 258
44 3300031711 Ga0265314_10000150 Ga0265314_100001506 258
45 3300031712 Ga0265342_10000703 Ga0265342_1000070322 258
46 3300044656 Ga0466969_0084123 Ga0466969_0084123_79_909 258
47 3300045049 Ga0466959_0018970 Ga0466959_0018970_3122_3952 258
48 3300047472 Ga0495686_0000030 Ga0495686_0000030_40650_41465 259
49 3300047472 Ga0495686_0004114 Ga0495686_0004114_5402_6208 259
50 3300048907 Ga0496104_0000074 Ga0496104_0000074_61119_61934 259
51 3300021388 Ga0213875_10000028 Ga0213875_1000002821 260
52 3300037853 Ga0436364_0302973 Ga0436364_0302973_21423_22214 260
53 3300047472 Ga0495686_0041586 Ga0495686_0041586_1874_2698 260
54 3300031235 Ga0265330_10002816 Ga0265330_100028168 261
55 3300031344 Ga0265316_10000442 Ga0265316_1000044211 261
56 3300048926 Ga0496123_0068861 Ga0496123_0068861_1414_2202 262
57 iso_pu_bacteria 2831905167 2831906911 264
58 3300031728 Ga0316578_10187547 Ga0316578_101875472 265
59 3300036712 Ga0316584_0207299 Ga0316584_0207299_465_1277 265
60 3300025291 Ga0209675_1029963 Ga0209675_10299631 266
61 3300061734 Ga0530510_0025185 Ga0530510_0025185_1913_2800 266
62 iso_pu_bacteria 2510917027 2511179165 266
63 iso_pu_bacteria 2512564013 2512636386 266
64 iso_pu_bacteria 2857460504 2857463107 266
65 iso_pu_bacteria 2857465823 2857471585 266
66 iso_pu_bacteria 2857591370 2857593104 266
67 iso_pu_bacteria 2898907183 2898907374 266
68 iso_pu_bacteria 2915597211 2915602442 266
69 iso_pu_bacteria 2915606848 2915612158 266
70 iso_pu_bacteria 2929183550 2929187606 266
71 3300005365 Ga0070688_100095029 Ga0070688_1000950292 269
72 3300009176 Ga0105242_10202733 Ga0105242_102027331 269
73 3300024225 Ga0224572_1002498 Ga0224572_10024983 269
74 3300026089 Ga0207648_10072725 Ga0207648_100727253 269
75 3300026116 Ga0207674_10019720 Ga0207674_100197206 269
76 3300048925 Ga0496122_0000500 Ga0496122_0000500_78873_79712 269
77 3300048926 Ga0496123_0039047 Ga0496123_0039047_367_1206 269
78 3300048928 Ga0496125_0121806 Ga0496125_0121806_395_1234 269
79 3300048929 Ga0496126_0000536 Ga0496126_0000536_1702_2541 269
80 3300046453 Ga0495627_032968 Ga0495627_032968_450_1274 270
81 3300025229 Ga0209147_100057 Ga0209147_100057215 271
82 iso_pu_bacteria 2904113452 2904114788 275
83 iso_pu_bacteria 2984527788 2984530335 275
84 iso_pu_bacteria 2984532647 2984536443 275
85 3300048924 Ga0496121_0120085 Ga0496121_0120085_644_1483 277
86 iso_pu_bacteria 2571042588 2573041455 277
87 iso_pu_bacteria 2576861424 2578337995 277
88 iso_pu_bacteria 2579778775 2580933950 277
89 iso_pu_bacteria 2600255286 2601639101 277
90 iso_pu_bacteria 2619619294 2621276371 277
91 iso_pu_bacteria 2881636855 2881640920 277
92 iso_pu_bacteria 2889049205 2889050357 277
93 iso_pu_bacteria 2971403814 2971407239 277
94 iso_pu_bacteria 2971511577 2971512595 277
95 iso_pu_bacteria 2980176882 2980177694 277
96 iso_pu_bacteria 2721755693 2723604968 278
97 iso_pu_bacteria 2728369359 2730135612 278
98 iso_pu_bacteria 2751185905 2753810986 278
99 iso_pu_bacteria 2802428803 2802437282 278
100 iso_pu_bacteria 2864733723 2864735385 278
101 iso_pu_bacteria 2889042446 2889046832 278
102 iso_pu_bacteria 2889276214 2889280881 278
103 iso_pu_bacteria 2904162308 2904163195 278
104 iso_pu_bacteria 2904595352 2904598340 278
105 iso_pu_bacteria 2907202186 2907205769 278
106 iso_pu_bacteria 2931384279 2931390280 278
107 iso_pu_bacteria 2939702853 2939704627 278
108 iso_pu_bacteria 2996706504 2996708224 278
109 iso_pu_bacteria 648028048 648171036 278
110 iso_pu_bacteria 8057977335 8057979098 278
111 3300041404 Ga0439436_0042249 Ga0439436_0042249_415_1266 279
112 3300041999 Ga0439433_0000516 Ga0439433_0000516_4659_5510 279
113 3300042015 Ga0439462_0000505 Ga0439462_0000505_1314_2165 279
114 iso_pu_bacteria 2563366752 2563926996 279
115 iso_pu_bacteria 2643221543 2643738030 279
116 iso_pu_bacteria 2821111986 2821114673 279
117 iso_pu_bacteria 2885526491 2885527968 279
118 iso_pu_bacteria 2904490793 2904493738 279
119 iso_pu_bacteria 2919160200 2919162818 279
120 iso_pu_bacteria 2939679117 2939679700 279
121 iso_pu_bacteria 2945991243 2945997495 279
122 iso_pu_bacteria 2946053406 2946053707 279
123 3300048919 Ga0496116_0005198 Ga0496116_0005198_5121_5972 282
124 3300048919 Ga0496116_0019761 Ga0496116_0019761_2110_2994 282
125 3300048920 Ga0496117_0014565 Ga0496117_0014565_4506_5357 282
126 3300048921 Ga0496118_0032540 Ga0496118_0032540_209_1093 282
127 3300048922 Ga0496119_0004713 Ga0496119_0004713_11940_12791 282
128 3300048923 Ga0496120_0000215 Ga0496120_0000215_51889_52740 282
129 3300048925 Ga0496122_0023471 Ga0496122_0023471_190_1074 282
130 3300048925 Ga0496122_0058148 Ga0496122_0058148_874_1725 282
131 3300048925 Ga0496122_0077867 Ga0496122_0077867_1019_1870 282
132 3300048927 Ga0496124_0001252 Ga0496124_0001252_2000_2851 282
133 3300048928 Ga0496125_0001763 Ga0496125_0001763_6501_7385 282
134 3300048929 Ga0496126_0001591 Ga0496126_0001591_21243_22094 282
135 3300048929 Ga0496126_0002005 Ga0496126_0002005_26768_27619 282
136 3300048929 Ga0496126_0008493 Ga0496126_0008493_1284_2168 282
137 3300009036 Ga0105244_10007057 Ga0105244_100070576 283
138 3300009036 Ga0105244_10052980 Ga0105244_100529802 283
139 3300011119 Ga0105246_10066725 Ga0105246_100667252 283
140 3300025233 Ga0209437_100793 Ga0209437_1007938 283
141 3300025728 Ga0207655_1010240 Ga0207655_10102407 283
142 3300045976 Ga0466967_0449903 Ga0466967_0449903_231_1106 283
143 3300048919 Ga0496116_0004229 Ga0496116_0004229_8759_9658 283
144 3300048924 Ga0496121_0085844 Ga0496121_0085844_1264_2163 283
145 3300048927 Ga0496124_0151530 Ga0496124_0151530_747_1646 283
146 3300003751 Ga0055538_1000091 Ga0055538_100009111 284
147 3300025224 Ga0209784_100135 Ga0209784_10013563 284

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02578

Cu-oxidase_4

Multi-copper polyphenol oxidoreductase laccase

45

295

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7fbg-assembly1.cif.gz_A kinetic and structural analysis by peptidoglycan editing factor from bacillus cereus atcc 14579 0.9712 1 282
7fbg-assembly1.cif.gz_A kinetic and structural analysis by peptidoglycan editing factor from bacillus cereus atcc 14579 0.9605 1 282
6t0y-assembly1.cif.gz_A crystal structure of ylmd from geobacillus stearothermophilus 0.9587 1 283
6dzd-assembly2.cif.gz_B crystal structure of bacillus licheniformis hypothetical protein yfih 0.9566 1 282
6t0y-assembly1.cif.gz_A crystal structure of ylmd from geobacillus stearothermophilus 0.9553 1 283
ID Description Score Start End Superfamily
1t8hA00 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.9585 1 284 3.60.140.10
1t8hA00 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.9516 1 284 3.60.140.10
af_Q2FZ88_1_221_3.60.140.10 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.9305 49 283 3.60.140.10
af_Q2FZ88_1_221_3.60.140.10 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.9265 49 283 3.60.140.10
af_P9WKD5_9_250_3.60.140.10 Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases 0.9113 21 282 3.60.140.10
ID Description Score Start End GO Terms
AF-A0A7C6ZP03-F1-model_v4 Laccase domain-containing protein 0.9809 110 284 GO:0004000
GO:0005507
GO:0017061
GO:0046936
AF-A0A3N5B0I9-F1-model_v4 Purine nucleoside phosphorylase 0.9788 28 282 GO:0004000
GO:0005507
GO:0017061
GO:0046936
AF-A0A101VD99-F1-model_v4 Purine nucleoside phosphorylase 0.9725 28 283 GO:0004000
GO:0005507
GO:0017061
GO:0046936
AF-A0A0F2PYK5-F1-model_v4 Purine nucleoside phosphorylase 0.9692 28 283 GO:0004000
GO:0005507
GO:0017061
GO:0046936
AF-A0A7V6YW42-F1-model_v4 Purine nucleoside phosphorylase 0.9691 1 284 GO:0005507
GO:0016740
GO:0016787

Feature Viewer

pLDDT pTM Quality
93.38 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map