F199997

General Info

Members Datasets Scaffolds Average Seq Length
147 112 147 160

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_100113648|Ga0070716_1001136482
Length 179
Sequence MKGMAHRPSSARSQAHRLTAMPNIFRPTFEDGERPEGFRSRRARIGYELGTELIGASLWEVPPGEAAYPYHFHYSDEELVIVLSGRPSLRTPEGIRELEEGEALRFPLGEEGAHQILNRTKETATFLAISSHGRPDVVVYPDSGKIGVGERLPKGGGLRAFFRRTDGVDYFDGERAYRD

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
58 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
59 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
60 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
61 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
64 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
65 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
66 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
67 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
75 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
78 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
79 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
80 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
81 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
82 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
83 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
86 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
87 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
88 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
89 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
90 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
91 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
92 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
93 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
94 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
95 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
96 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
97 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
98 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
103 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
104 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
105 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
107 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
108 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
109 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
110 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
111 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
112 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 6.8
Rhizosphere 89.8
Stem 0
Stem Tuber 0
Unclassified 2.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002815 3300001979 Bacteria 7776
2 JGI24740J21852_10038967 3300001979 Bacteria 1453
3 JGI25407J50210_10000453 3300003373 Bacteria 8090
4 Ga0070683_100299949 3300005329 Unclassified 1528
5 Ga0070677_10000004 3300005333 Bacteria 81101
6 Ga0068869_100459403 3300005334 Bacteria 1057
7 Ga0070688_100000028 3300005365 Bacteria 67085
8 Ga0070688_100053579 3300005365 Unclassified 2524
9 Ga0070667_100141131 3300005367 Bacteria 2110
10 Ga0070713_100030463 3300005436 Bacteria 4285
11 Ga0070678_100016179 3300005456 Bacteria 4764
12 Ga0070681_10007735 3300005458 Bacteria 10506
13 Ga0070685_10000027 3300005466 Bacteria 91882
14 Ga0070685_10362279 3300005466 Bacteria 994
15 Ga0070679_100003822 3300005530 Bacteria 13829
16 Ga0070684_100077495 3300005535 Bacteria 2936
17 Ga0070696_100703011 3300005546 Unclassified 824
18 Ga0070665_100000202 3300005548 Bacteria 104773
19 Ga0068856_100140847 3300005614 Bacteria 2419
20 Ga0068852_100000104 3300005616 Bacteria 56243
21 Ga0068870_10223418 3300005840 Bacteria 1154
22 Ga0068858_100000012 3300005842 Bacteria 216931
23 Ga0068858_100000043 3300005842 Bacteria 132444
24 Ga0081455_10008816 3300005937 Bacteria 10437
25 Ga0081538_10000280 3300005981 Bacteria 58428
26 Ga0070717_10000028 3300006028 Bacteria 144976
27 Ga0070715_10130118 3300006163 Unclassified 1210
28 Ga0070716_100113648 3300006173 Bacteria 1682
29 Ga0075433_10000002 3300006852 Bacteria 92986
30 Ga0105240_11109759 3300009093 Unclassified 841
31 Ga0105245_10000016 3300009098 Bacteria 204372
32 Ga0105245_10000023 3300009098 Bacteria 180844
33 Ga0105245_10005382 3300009098 Bacteria 11251
34 Ga0105245_10525578 3300009098 Bacteria 1202
35 Ga0105247_10009385 3300009101 Bacteria 5941
36 Ga0105243_10454919 3300009148 Bacteria 1202
37 Ga0105242_10002493 3300009176 Bacteria 14435
38 Ga0105249_10000068 3300009553 Bacteria 148594
39 Ga0105249_10013975 3300009553 Bacteria 7097
40 Ga0105249_10343583 3300009553 Bacteria 1510
41 Ga0157369_10000051 3300013105 Bacteria 165672
42 Ga0157378_11077507 3300013297 Bacteria 840
43 Ga0157375_10020943 3300013308 Bacteria 5984
44 Ga0157375_10481720 3300013308 Bacteria 1406
45 Ga0157379_10011898 3300014968 Bacteria 7603
46 Ga0157376_10034362 3300014969 Bacteria 4094
47 Ga0207653_10079396 3300025885 Bacteria 1134
48 Ga0207682_10000031 3300025893 Bacteria 57806
49 Ga0207710_10000158 3300025900 Bacteria 72527
50 Ga0207707_10009620 3300025912 Bacteria 8384
51 Ga0207663_10014462 3300025916 Bacteria 4320
52 Ga0207652_10000549 3300025921 Bacteria 38051
53 Ga0207687_10000015 3300025927 Bacteria 261701
54 Ga0207687_10000018 3300025927 Bacteria 236159
55 Ga0207687_10000055 3300025927 Bacteria 88382
56 Ga0207700_10022422 3300025928 Bacteria 4334
57 Ga0207686_10001608 3300025934 Bacteria 12650
58 Ga0207665_10413336 3300025939 Bacteria 1029
59 Ga0207689_10894870 3300025942 Bacteria 749
60 Ga0207661_10030085 3300025944 Bacteria 4178
61 Ga0207712_10000007 3300025961 Bacteria 539589
62 Ga0207712_10001237 3300025961 Bacteria 17637
63 Ga0207658_10131775 3300025986 Bacteria 2009
64 Ga0207658_10443099 3300025986 Bacteria 1148
65 Ga0207703_10000053 3300026035 Bacteria 143924
66 Ga0207703_10000310 3300026035 Bacteria 52770
67 Ga0207702_10013165 3300026078 Bacteria 6878
68 Ga0207683_10030435 3300026121 Bacteria 4678
69 Ga0207698_10000015 3300026142 Bacteria 207368
70 Ga0268266_10000020 3300028379 Bacteria 527065
71 Ga0268266_10473324 3300028379 Bacteria 1193
72 Ga0268264_10032916 3300028381 Bacteria 4254
73 Ga0265337_1002155 3300028556 Bacteria 9255
74 Ga0265326_10000102 3300028558 Bacteria 43681
75 Ga0265334_10000290 3300028573 Bacteria 28241
76 Ga0265322_10000001 3300028654 Bacteria 543854
77 Ga0265336_10037314 3300028666 Bacteria 1494
78 Ga0265338_10006107 3300028800 Bacteria 15464
79 Ga0265338_10234897 3300028800 Unclassified 1361
80 Ga0265324_10000850 3300029957 Bacteria 19624
81 Ga0265324_10001742 3300029957 Bacteria 11980
82 Ga0307511_10167865 3300030521 Bacteria 1214
83 Ga0265328_10000316 3300031239 Bacteria 22478
84 Ga0265320_10000002 3300031240 Bacteria 542875
85 Ga0265329_10011172 3300031242 Bacteria 3269
86 Ga0265339_10069641 3300031249 Bacteria 1877
87 Ga0265331_10000751 3300031250 Bacteria 27117
88 Ga0265327_10000011 3300031251 Bacteria 543807
89 Ga0265316_10150805 3300031344 Bacteria 1742
90 Ga0265314_10000062 3300031711 Bacteria 159496
91 Ga0307406_10468824 3300031901 Bacteria 1014
92 Ga0436365_1328126 3300039437 Unclassified 727
93 Ga0451853_2825101 3300041512 Bacteria 4231
94 Ga0466957_0094431 3300044842 Unclassified 1878
95 Ga0466957_0137036 3300044842 Bacteria 1574
96 Ga0495641_0000003 3300046461 Bacteria 242879
97 Ga0495641_0158570 3300046461 Bacteria 1012
98 Ga0495651_0298124 3300046462 Bacteria 1082
99 Ga0495653_0846386 3300046463 Bacteria 547
100 Ga0495608_0000068 3300046511 Bacteria 79694
101 Ga0495628_0146640 3300046516 Bacteria 1799
102 Ga0495630_0000408 3300046517 Bacteria 33471
103 Ga0495630_0083525 3300046517 Bacteria 2411
104 Ga0495630_0300008 3300046517 Bacteria 1228
105 Ga0495630_1123107 3300046517 Bacteria 595
106 Ga0495586_0018569 3300046535 Bacteria 3702
107 Ga0495645_0009482 3300046543 Bacteria 6803
108 Ga0495634_0000247 3300046642 Bacteria 50931
109 Ga0495634_0005521 3300046642 Bacteria 9712
110 Ga0495634_0301894 3300046642 Unclassified 968
111 Ga0495635_0046415 3300046663 Bacteria 2997
112 Ga0495657_0000004 3300046675 Bacteria 266465
113 Ga0495657_0124122 3300046675 Unclassified 1623
114 Ga0495657_0243535 3300046675 Unclassified 1084
115 Ga0495613_0244202 3300046689 Unclassified 1255
116 Ga0495649_0004968 3300046694 Bacteria 8562
117 Ga0495581_0622486 3300047315 Bacteria 625
118 Ga0495604_0282267 3300047317 Bacteria 1121
119 Ga0495674_1214955 3300047319 Bacteria 569
120 Ga0495672_0024572 3300047320 Bacteria 3878
121 Ga0495676_0001167 3300047321 Bacteria 22398
122 Ga0495680_0000196 3300047322 Bacteria 65437
123 Ga0495680_0121981 3300047322 Bacteria 1923
124 Ga0495675_0000107 3300047444 Bacteria 59970
125 Ga0496104_0000004 3300048907 Bacteria 641830
126 Ga0496104_0000009 3300048907 Bacteria 488055
127 Ga0496105_0000001 3300048908 Bacteria 1328178
128 Ga0496105_0000027 3300048908 Bacteria 148197
129 Ga0496109_0627404 3300048912 Bacteria 1011
130 Ga0496110_0209713 3300048913 Bacteria 1771
131 Ga0496111_0138382 3300048914 Bacteria 1804
132 Ga0496111_0347089 3300048914 Bacteria 1099
133 Ga0496112_1331923 3300048915 Unclassified 633
134 Ga0496114_0076287 3300048917 Bacteria 2824
135 Ga0496120_0204366 3300048923 Unclassified 954
136 Ga0501048_0681808 3300049582 Bacteria 738
137 Ga0501072_0141433 3300049588 Unclassified 1919
138 nmdc:mga0a205_13_c1 3300050515 Bacteria 111131
139 Ga0495601_0000072 3300053077 Bacteria 56009
140 Ga0495601_0010373 3300053077 Bacteria 5543
141 Ga0495655_0212032 3300053083 Unclassified 638
142 Ga0495595_0000003 3300053084 Bacteria 266465
143 Ga0495619_0000024 3300053085 Bacteria 180821
144 Ga0495619_0000106 3300053085 Bacteria 62413
145 Ga0495619_0001003 3300053085 Bacteria 18481
146 Ga0495619_0003474 3300053085 Bacteria 10169
147 Ga0500614_000325 3300053123 Bacteria 12366

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005535 Ga0070684_100077495 Ga0070684_1000774953 145
2 3300005616 Ga0068852_100000104 Ga0068852_10000010455 145
3 3300026142 Ga0207698_10000015 Ga0207698_1000001530 145
4 3300046462 Ga0495651_0298124 Ga0495651_0298124_283_765 151
5 3300005333 Ga0070677_10000004 Ga0070677_1000000414 152
6 3300005365 Ga0070688_100000028 Ga0070688_10000002850 152
7 3300005466 Ga0070685_10000027 Ga0070685_1000002743 152
8 3300005614 Ga0068856_100140847 Ga0068856_1001408472 152
9 3300009098 Ga0105245_10000016 Ga0105245_1000001679 152
10 3300009098 Ga0105245_10000023 Ga0105245_10000023138 152
11 3300009553 Ga0105249_10000068 Ga0105249_10000068120 152
12 3300013105 Ga0157369_10000051 Ga0157369_1000005175 152
13 3300014968 Ga0157379_10011898 Ga0157379_100118988 152
14 3300025893 Ga0207682_10000031 Ga0207682_1000003153 152
15 3300025927 Ga0207687_10000015 Ga0207687_1000001544 152
16 3300025927 Ga0207687_10000018 Ga0207687_10000018145 152
17 3300025961 Ga0207712_10000007 Ga0207712_10000007272 152
18 3300026078 Ga0207702_10013165 Ga0207702_100131653 152
19 3300048907 Ga0496104_0000009 Ga0496104_0000009_143386_143865 152
20 3300048908 Ga0496105_0000027 Ga0496105_0000027_4660_5139 152
21 3300005456 Ga0070678_100016179 Ga0070678_1000161793 153
22 3300005840 Ga0068870_10223418 Ga0068870_102234182 153
23 3300026121 Ga0207683_10030435 Ga0207683_100304353 153
24 3300046642 Ga0495634_0005521 Ga0495634_0005521_2494_2979 153
25 3300028556 Ga0265337_1002155 Ga0265337_10021556 155
26 3300028558 Ga0265326_10000102 Ga0265326_1000010217 155
27 3300028654 Ga0265322_10000001 Ga0265322_10000001328 155
28 3300028666 Ga0265336_10037314 Ga0265336_100373142 155
29 3300028800 Ga0265338_10234897 Ga0265338_102348972 155
30 3300029957 Ga0265324_10000850 Ga0265324_100008507 155
31 3300031239 Ga0265328_10000316 Ga0265328_100003168 155
32 3300031240 Ga0265320_10000002 Ga0265320_10000002327 155
33 3300031242 Ga0265329_10011172 Ga0265329_100111722 155
34 3300031249 Ga0265339_10069641 Ga0265339_100696413 155
35 3300031250 Ga0265331_10000751 Ga0265331_1000075110 155
36 3300031251 Ga0265327_10000011 Ga0265327_10000011327 155
37 3300031344 Ga0265316_10150805 Ga0265316_101508053 155
38 3300031711 Ga0265314_10000062 Ga0265314_1000006261 155
39 3300031901 Ga0307406_10468824 Ga0307406_104688242 155
40 3300001979 JGI24740J21852_10002815 JGI24740J21852_100028155 158
41 3300001979 JGI24740J21852_10038967 JGI24740J21852_100389672 158
42 3300003373 JGI25407J50210_10000453 JGI25407J50210_100004535 158
43 3300005329 Ga0070683_100299949 Ga0070683_1002999493 158
44 3300005334 Ga0068869_100459403 Ga0068869_1004594031 158
45 3300005365 Ga0070688_100053579 Ga0070688_1000535792 158
46 3300005367 Ga0070667_100141131 Ga0070667_1001411313 158
47 3300005436 Ga0070713_100030463 Ga0070713_1000304632 158
48 3300005458 Ga0070681_10007735 Ga0070681_1000773511 158
49 3300005466 Ga0070685_10362279 Ga0070685_103622792 158
50 3300005530 Ga0070679_100003822 Ga0070679_1000038222 158
51 3300005546 Ga0070696_100703011 Ga0070696_1007030112 158
52 3300005548 Ga0070665_100000202 Ga0070665_10000020293 158
53 3300005842 Ga0068858_100000012 Ga0068858_10000001227 158
54 3300005842 Ga0068858_100000043 Ga0068858_100000043116 158
55 3300005937 Ga0081455_10008816 Ga0081455_100088166 158
56 3300005981 Ga0081538_10000280 Ga0081538_1000028022 158
57 3300006028 Ga0070717_10000028 Ga0070717_10000028115 158
58 3300006163 Ga0070715_10130118 Ga0070715_101301182 158
59 3300006173 Ga0070716_100113648 Ga0070716_1001136482 158
60 3300006852 Ga0075433_10000002 Ga0075433_1000000255 158
61 3300009093 Ga0105240_11109759 Ga0105240_111097591 158
62 3300009098 Ga0105245_10005382 Ga0105245_1000538211 158
63 3300009098 Ga0105245_10525578 Ga0105245_105255783 158
64 3300009101 Ga0105247_10009385 Ga0105247_100093855 158
65 3300009148 Ga0105243_10454919 Ga0105243_104549192 158
66 3300009176 Ga0105242_10002493 Ga0105242_100024936 158
67 3300009553 Ga0105249_10013975 Ga0105249_100139752 158
68 3300009553 Ga0105249_10343583 Ga0105249_103435832 158
69 3300013297 Ga0157378_11077507 Ga0157378_110775071 158
70 3300013308 Ga0157375_10020943 Ga0157375_100209434 158
71 3300013308 Ga0157375_10481720 Ga0157375_104817202 158
72 3300014969 Ga0157376_10034362 Ga0157376_100343623 158
73 3300025885 Ga0207653_10079396 Ga0207653_100793962 158
74 3300025900 Ga0207710_10000158 Ga0207710_1000015811 158
75 3300025912 Ga0207707_10009620 Ga0207707_100096202 158
76 3300025916 Ga0207663_10014462 Ga0207663_100144624 158
77 3300025921 Ga0207652_10000549 Ga0207652_1000054940 158
78 3300025927 Ga0207687_10000055 Ga0207687_1000005561 158
79 3300025928 Ga0207700_10022422 Ga0207700_100224222 158
80 3300025934 Ga0207686_10001608 Ga0207686_100016086 158
81 3300025939 Ga0207665_10413336 Ga0207665_104133362 158
82 3300025942 Ga0207689_10894870 Ga0207689_108948701 158
83 3300025944 Ga0207661_10030085 Ga0207661_100300853 158
84 3300025961 Ga0207712_10001237 Ga0207712_100012378 158
85 3300025986 Ga0207658_10131775 Ga0207658_101317752 158
86 3300025986 Ga0207658_10443099 Ga0207658_104430992 158
87 3300026035 Ga0207703_10000053 Ga0207703_1000005347 158
88 3300026035 Ga0207703_10000310 Ga0207703_1000031059 158
89 3300028379 Ga0268266_10000020 Ga0268266_10000020184 158
90 3300028379 Ga0268266_10473324 Ga0268266_104733241 158
91 3300028381 Ga0268264_10032916 Ga0268264_100329163 158
92 3300028573 Ga0265334_10000290 Ga0265334_1000029019 158
93 3300028800 Ga0265338_10006107 Ga0265338_100061073 158
94 3300029957 Ga0265324_10001742 Ga0265324_100017424 158
95 3300030521 Ga0307511_10167865 Ga0307511_101678652 158
96 3300039437 Ga0436365_1328126 Ga0436365_1328126_198_689 158
97 3300041512 Ga0451853_2825101 Ga0451853_2825101_420_899 158
98 3300044842 Ga0466957_0094431 Ga0466957_0094431_1127_1615 158
99 3300044842 Ga0466957_0137036 Ga0466957_0137036_645_1130 158
100 3300046461 Ga0495641_0000003 Ga0495641_0000003_82764_83243 158
101 3300046461 Ga0495641_0158570 Ga0495641_0158570_83_571 158
102 3300046463 Ga0495653_0846386 Ga0495653_0846386_38_526 158
103 3300046511 Ga0495608_0000068 Ga0495608_0000068_18011_18490 158
104 3300046516 Ga0495628_0146640 Ga0495628_0146640_835_1314 158
105 3300046517 Ga0495630_0000408 Ga0495630_0000408_25_513 158
106 3300046517 Ga0495630_0083525 Ga0495630_0083525_1528_2040 158
107 3300046517 Ga0495630_0300008 Ga0495630_0300008_316_795 158
108 3300046517 Ga0495630_1123107 Ga0495630_1123107_85_576 158
109 3300046535 Ga0495586_0018569 Ga0495586_0018569_1809_2300 158
110 3300046543 Ga0495645_0009482 Ga0495645_0009482_3283_3765 158
111 3300046642 Ga0495634_0000247 Ga0495634_0000247_33085_33573 158
112 3300046642 Ga0495634_0301894 Ga0495634_0301894_42_530 158
113 3300046663 Ga0495635_0046415 Ga0495635_0046415_1170_1661 158
114 3300046675 Ga0495657_0000004 Ga0495657_0000004_61760_62239 158
115 3300046675 Ga0495657_0124122 Ga0495657_0124122_755_1243 158
116 3300046675 Ga0495657_0243535 Ga0495657_0243535_203_685 158
117 3300046689 Ga0495613_0244202 Ga0495613_0244202_450_962 158
118 3300046694 Ga0495649_0004968 Ga0495649_0004968_6953_7432 158
119 3300047315 Ga0495581_0622486 Ga0495581_0622486_72_560 158
120 3300047317 Ga0495604_0282267 Ga0495604_0282267_213_698 158
121 3300047319 Ga0495674_1214955 Ga0495674_1214955_14_502 158
122 3300047320 Ga0495672_0024572 Ga0495672_0024572_489_977 158
123 3300047321 Ga0495676_0001167 Ga0495676_0001167_11788_12267 158
124 3300047322 Ga0495680_0000196 Ga0495680_0000196_44817_45296 158
125 3300047322 Ga0495680_0121981 Ga0495680_0121981_183_674 158
126 3300047444 Ga0495675_0000107 Ga0495675_0000107_15546_16025 158
127 3300048907 Ga0496104_0000004 Ga0496104_0000004_107031_107510 158
128 3300048908 Ga0496105_0000001 Ga0496105_0000001_534321_534800 158
129 3300048912 Ga0496109_0627404 Ga0496109_0627404_36_530 158
130 3300048913 Ga0496110_0209713 Ga0496110_0209713_250_729 158
131 3300048914 Ga0496111_0138382 Ga0496111_0138382_208_687 158
132 3300048914 Ga0496111_0347089 Ga0496111_0347089_245_733 158
133 3300048915 Ga0496112_1331923 Ga0496112_1331923_120_614 158
134 3300048917 Ga0496114_0076287 Ga0496114_0076287_2009_2488 158
135 3300048923 Ga0496120_0204366 Ga0496120_0204366_214_693 158
136 3300049582 Ga0501048_0681808 Ga0501048_0681808_85_570 158
137 3300049588 Ga0501072_0141433 Ga0501072_0141433_247_741 158
138 3300050515 nmdc:mga0a205_13_c1 nmdc:mga0a205_13_c1_48966_49451 158
139 3300053077 Ga0495601_0000072 Ga0495601_0000072_50886_51371 158
140 3300053077 Ga0495601_0010373 Ga0495601_0010373_3839_4327 158
141 3300053083 Ga0495655_0212032 Ga0495655_0212032_69_575 158
142 3300053084 Ga0495595_0000003 Ga0495595_0000003_61760_62239 158
143 3300053085 Ga0495619_0000024 Ga0495619_0000024_68655_69131 158
144 3300053085 Ga0495619_0000106 Ga0495619_0000106_43934_44413 158
145 3300053085 Ga0495619_0001003 Ga0495619_0001003_14365_14856 158
146 3300053085 Ga0495619_0003474 Ga0495619_0003474_143_631 158
147 3300053123 Ga0500614_000325 Ga0500614_000325_9192_9671 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

57

130

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3es1-assembly1.cif.gz_A-2 crystal structure of protein with a cupin-like fold and unknown function (yp_001165807.1) from novosphingobium aromaticivorans dsm 12444 at 1.91 a resolution 0.8943 34 110
6o2d-assembly1.cif.gz_A schizosaccharomyces pombe cnp3 cupin domain 0.8856 3 110
5jsp-assembly1.cif.gz_A new mechanistic insight from substrate and product bound structures of the metal-dependent dimethylsulfoniopropionate lyase dddq 0.8827 34 110
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.8738 33 109
5wse-assembly1.cif.gz_D crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i 0.8664 1 110
ID Description Score Start End Superfamily
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9057 34 110 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9029 33 110 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9008 20 110 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8888 20 110 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8769 20 110 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7W0PJV1-F1-model_v4 Cupin domain-containing protein 0.9725 38 144
AF-A0A2W6BXD1-F1-model_v4 Cupin type-2 domain-containing protein 0.9613 2 150 GO:0046872
AF-A0A538C477-F1-model_v4 Cupin domain-containing protein 0.9604 3 150 GO:0046872
AF-A0A1W9EZW7-F1-model_v4 deleted 0.9552 34 123
AF-A0A1K2HRM8-F1-model_v4 Cupin domain-containing protein 0.953 20 121 GO:0046872

Feature Viewer

pLDDT pTM Quality
84.92 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map