F197414

General Info

Members Datasets Scaffolds Average Seq Length
146 100 292 127

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10444001|Ga0111539_104440012
Length 146
Sequence MVHAICVGRPSALDRLRRVHIVGAFFIESMDLRQVPGPSTRIDLTGVHFSLAAPSPVPVTLEPHLLVLVHCPEDASGSGALEVTYQRDGEQVARSVQPLQVEPGKFNYRLVRAELGFESYGTVEARCRIDFGTEMVVPFTLLPPAG

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
7 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
8 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
9 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
11 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
12 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
13 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
14 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
15 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
16 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
17 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
18 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
19 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
20 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
21 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
22 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
23 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
30 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
31 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
32 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
33 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
34 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
35 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
36 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
37 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
38 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
39 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
40 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
41 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
42 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
43 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
44 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
45 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
46 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
47 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
48 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
49 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
50 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
51 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
52 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
53 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
54 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
55 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
56 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
57 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
58 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
59 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
60 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
61 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
62 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
63 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
64 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
65 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
66 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
67 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
68 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
69 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
70 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
79 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
80 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
81 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
82 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
83 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
84 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
85 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
86 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
87 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
88 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
89 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
91 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
92 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
93 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
94 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
95 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
96 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
97 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
98 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
99 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
100 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.49
Nodule 0
Rhizoplane 2.74
Rhizosphere 69.86
Stem 0
Stem Tuber 0
Unclassified 11.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10444001 3300009094 Bacteria 1511
2 Ga0065707_10239118 3300005295 Unclassified 1162
3 Ga0070676_10652121 3300005328 Unclassified 764
4 Ga0070659_100625200 3300005366 Unclassified 927
5 Ga0070667_100221994 3300005367 Bacteria 1682
6 Ga0070693_100541235 3300005547 Bacteria 832
7 Ga0068852_101440176 3300005616 Bacteria 711
8 Ga0068858_100580861 3300005842 Bacteria 1086
9 Ga0081539_10067983 3300005985 Bacteria 1924
10 Ga0075365_10048002 3300006038 Bacteria 2809
11 Ga0075363_100265832 3300006048 Bacteria 990
12 Ga0075364_10104897 3300006051 Bacteria 1883
13 Ga0075364_10308911 3300006051 Bacteria 1077
14 Ga0075367_10007860 3300006178 Bacteria 5489
15 Ga0075367_10015214 3300006178 Bacteria 4177
16 Ga0075367_10152622 3300006178 Bacteria 1434
17 Ga0075367_10213931 3300006178 Bacteria 1205
18 Ga0075367_10450899 3300006178 Bacteria 815
19 Ga0075367_10629816 3300006178 Bacteria 682
20 Ga0075433_11153463 3300006852 Unclassified 673
21 Ga0105245_10266359 3300009098 Bacteria 1669
22 Ga0105245_11590214 3300009098 Bacteria 705
23 Ga0105241_10473049 3300009174 Unclassified 1112
24 Ga0105242_10115323 3300009176 Bacteria 2296
25 Ga0105239_10565498 3300010375 Bacteria 1295
26 Ga0157374_11594298 3300013296 Bacteria 677
27 Ga0157375_11869291 3300013308 Bacteria 712
28 Ga0157379_10332055 3300014968 Bacteria 1389
29 Ga0213876_10006171 3300021384 Bacteria 6537
30 Ga0207654_10179689 3300025911 Unclassified 1380
31 Ga0207687_10023494 3300025927 Bacteria 4111
32 Ga0207687_10407889 3300025927 Bacteria 1119
33 Ga0207670_10916549 3300025936 Bacteria 734
34 Ga0207668_11623528 3300025972 Bacteria 584
35 Ga0207708_11739830 3300026075 Bacteria 547
36 Ga0207683_10099153 3300026121 Bacteria 2600
37 Ga0316575_10023104 3300031665 Bacteria 2402
38 Ga0316575_10048689 3300031665 Bacteria 1686
39 Ga0316575_10095578 3300031665 Bacteria 1206
40 Ga0316576_10067082 3300031727 Bacteria 2641
41 Ga0316576_10327802 3300031727 Bacteria 1141
42 Ga0316578_10163474 3300031728 Bacteria 1341
43 Ga0307405_10434423 3300031731 Bacteria 1037
44 Ga0316577_10015228 3300031733 Bacteria 4231
45 Ga0307410_11068292 3300031852 Bacteria 699
46 Ga0307407_10205993 3300031903 Bacteria 1321
47 Ga0307407_10601855 3300031903 Bacteria 819
48 Ga0307416_100756465 3300032002 Unclassified 1065
49 Ga0307416_101545233 3300032002 Bacteria 769
50 Ga0307416_103656818 3300032002 Unclassified 515
51 Ga0307411_10779047 3300032005 Bacteria 840
52 Ga0307415_100105870 3300032126 Bacteria 2075
53 Ga0307415_100438826 3300032126 Bacteria 1125
54 Ga0307415_100527984 3300032126 Bacteria 1037
55 Ga0316580_10031492 3300032139 Bacteria 1642
56 Ga0373957_0374808 3300035120 Bacteria 610
57 Ga0316574_0005629 3300035398 Bacteria 6701
58 Ga0316582_0002839 3300036647 Bacteria 8295
59 Ga0316584_0004975 3300036712 Bacteria 8849
60 Ga0316584_1185417 3300036712 Unclassified 504
61 Ga0400485_00826 3300038735 Bacteria 1164
62 Ga0400485_03390 3300038735 Bacteria 8315
63 Ga0400483_079369 3300039062 Bacteria 8668
64 Ga0400483_102257 3300039062 Bacteria 1999
65 Ga0400483_113044 3300039062 Bacteria 29084
66 Ga0400483_130437 3300039062 Bacteria 2267
67 Ga0400483_242918 3300039062 Bacteria 4560
68 Ga0400483_285631 3300039062 Unclassified 3502
69 Ga0436365_0482887 3300039437 Bacteria 16518
70 Ga0451798_0106440 3300041458 Bacteria 505
71 Ga0451802_0300405 3300041460 Bacteria 567
72 Ga0451837_0245760 3300041494 Bacteria 1090
73 Ga0451837_1305528 3300041494 Bacteria 529
74 Ga0451853_0088020 3300041512 Bacteria 630
75 Ga0450908_015240 3300042184 Bacteria 1378
76 Ga0495629_0268404 3300046459 Bacteria 1172
77 Ga0495582_0194124 3300046473 Bacteria 1159
78 Ga0495639_0015447 3300046475 Bacteria 3311
79 Ga0495583_0098011 3300046506 Bacteria 1254
80 Ga0495630_0018454 3300046517 Bacteria 5125
81 Ga0495630_0219714 3300046517 Unclassified 1451
82 Ga0495640_0112696 3300046533 Unclassified 1776
83 Ga0495586_0622403 3300046535 Bacteria 624
84 Ga0495634_0047028 3300046642 Bacteria 2909
85 Ga0495588_0171030 3300046674 Unclassified 1149
86 Ga0495647_0104505 3300046681 Bacteria 1176
87 Ga0495658_0292720 3300046683 Unclassified 1029
88 Ga0495658_0467956 3300046683 Bacteria 806
89 Ga0495613_0000713 3300046689 Bacteria 26030
90 Ga0495676_0564893 3300047321 Bacteria 743
91 Ga0495676_0567280 3300047321 Bacteria 741
92 Ga0495680_0660402 3300047322 Bacteria 694
93 Ga0495675_0338629 3300047444 Bacteria 887
94 Ga0495614_0141783 3300048089 Bacteria 1068
95 Ga0496109_1289110 3300048912 Bacteria 667
96 Ga0496114_0161985 3300048917 Bacteria 1946
97 Ga0501032_0073645 3300049569 Bacteria 2275
98 Ga0501033_0582288 3300049570 Bacteria 769
99 Ga0501034_0010350 3300049571 Bacteria 9720
100 Ga0501034_0048326 3300049571 Bacteria 4295
101 Ga0501034_0793173 3300049571 Bacteria 840
102 Ga0501034_0821698 3300049571 Bacteria 821
103 Ga0501036_1083274 3300049572 Bacteria 655
104 Ga0501037_0007154 3300049573 Bacteria 8158
105 Ga0501038_0040931 3300049574 Bacteria 4043
106 Ga0501040_0486249 3300049576 Bacteria 890
107 Ga0501047_0725721 3300049581 Bacteria 810
108 Ga0501067_0663902 3300049583 Bacteria 585
109 Ga0501070_0018774 3300049586 Bacteria 5801
110 Ga0501070_0240228 3300049586 Bacteria 1483
111 Ga0501071_0186455 3300049587 Bacteria 1555
112 Ga0501072_0112484 3300049588 Bacteria 2168
113 Ga0501072_0562144 3300049588 Unclassified 900
114 Ga0501073_0874338 3300049589 Bacteria 619
115 Ga0501074_0218936 3300049590 Bacteria 1356
116 Ga0501074_1142338 3300049590 Bacteria 547
117 Ga0501075_0345610 3300049591 Bacteria 1134
118 Ga0501076_0377084 3300049592 Bacteria 1166
119 Ga0501079_0943848 3300049741 Bacteria 679
120 Ga0501079_1410111 3300049741 Bacteria 548
121 Ga0501080_0044828 3300049742 Bacteria 4116
122 Ga0501080_0249312 3300049742 Bacteria 1619
123 Ga0501080_0687809 3300049742 Bacteria 903
124 Ga0501081_0357643 3300049743 Bacteria 1077
125 Ga0501081_0534364 3300049743 Unclassified 875
126 Ga0501035_0025059 3300049822 Bacteria 5469
127 Ga0501044_0016372 3300049823 Bacteria 7962
128 nmdc:mga03683_303636_c1 3300050489 Bacteria 749
129 nmdc:mga03n38_176025_c1 3300050490 Bacteria 1093
130 nmdc:mga03n38_291313_c1 3300050490 Bacteria 874
131 nmdc:mga00v17_256831_c1 3300050491 Bacteria 1133
132 nmdc:mga00v17_3011_c1 3300050491 Bacteria 8658
133 nmdc:mga00v17_481306_c1 3300050491 Bacteria 805
134 nmdc:mga00v17_7210_c1 3300050491 Bacteria 5923
135 nmdc:mga0yw44_128824_c1 3300050492 Bacteria 1636
136 nmdc:mga0yw44_157618_c1 3300050492 Bacteria 1484
137 nmdc:mga06z11_139793_c1 3300050494 Bacteria 1368
138 nmdc:mga06z11_348114_c1 3300050494 Bacteria 887
139 nmdc:mga06z11_642968_c1 3300050494 Bacteria 646
140 nmdc:mga06z11_90604_c1 3300050494 Bacteria 1659
141 nmdc:mga04h51_58161_c1 3300050495 Bacteria 1317
142 nmdc:mga04h51_90120_c1 3300050495 Bacteria 1102
143 nmdc:mga0rr50_849690_c1 3300050513 Bacteria 778
144 Ga0500583_0059600 3300053092 Unclassified 1798
145 Ga0500566_0175723 3300053094 Bacteria 1103
146 Ga0501082_0245560 3300060353 Bacteria 1558
147 Ga0111539_10444001
148 Ga0065707_10239118
149 Ga0070676_10652121
150 Ga0070659_100625200
151 Ga0070667_100221994
152 Ga0070693_100541235
153 Ga0068852_101440176
154 Ga0068858_100580861
155 Ga0081539_10067983
156 Ga0075365_10048002
157 Ga0075363_100265832
158 Ga0075364_10104897
159 Ga0075364_10308911
160 Ga0075367_10007860
161 Ga0075367_10015214
162 Ga0075367_10152622
163 Ga0075367_10213931
164 Ga0075367_10450899
165 Ga0075367_10629816
166 Ga0075433_11153463
167 Ga0105245_10266359
168 Ga0105245_11590214
169 Ga0105241_10473049
170 Ga0105242_10115323
171 Ga0105239_10565498
172 Ga0157374_11594298
173 Ga0157375_11869291
174 Ga0157379_10332055
175 Ga0213876_10006171
176 Ga0207654_10179689
177 Ga0207687_10023494
178 Ga0207687_10407889
179 Ga0207670_10916549
180 Ga0207668_11623528
181 Ga0207708_11739830
182 Ga0207683_10099153
183 Ga0316575_10023104
184 Ga0316575_10048689
185 Ga0316575_10095578
186 Ga0316576_10067082
187 Ga0316576_10327802
188 Ga0316578_10163474
189 Ga0307405_10434423
190 Ga0316577_10015228
191 Ga0307410_11068292
192 Ga0307407_10205993
193 Ga0307407_10601855
194 Ga0307416_100756465
195 Ga0307416_101545233
196 Ga0307416_103656818
197 Ga0307411_10779047
198 Ga0307415_100105870
199 Ga0307415_100438826
200 Ga0307415_100527984
201 Ga0316580_10031492
202 Ga0373957_0374808
203 Ga0316574_0005629
204 Ga0316582_0002839
205 Ga0316584_0004975
206 Ga0316584_1185417
207 Ga0400485_00826
208 Ga0400485_03390
209 Ga0400483_079369
210 Ga0400483_102257
211 Ga0400483_113044
212 Ga0400483_130437
213 Ga0400483_242918
214 Ga0400483_285631
215 Ga0436365_0482887
216 Ga0451798_0106440
217 Ga0451802_0300405
218 Ga0451837_0245760
219 Ga0451837_1305528
220 Ga0451853_0088020
221 Ga0450908_015240
222 Ga0495629_0268404
223 Ga0495582_0194124
224 Ga0495639_0015447
225 Ga0495583_0098011
226 Ga0495630_0018454
227 Ga0495630_0219714
228 Ga0495640_0112696
229 Ga0495586_0622403
230 Ga0495634_0047028
231 Ga0495588_0171030
232 Ga0495647_0104505
233 Ga0495658_0292720
234 Ga0495658_0467956
235 Ga0495613_0000713
236 Ga0495676_0564893
237 Ga0495676_0567280
238 Ga0495680_0660402
239 Ga0495675_0338629
240 Ga0495614_0141783
241 Ga0496109_1289110
242 Ga0496114_0161985
243 Ga0501032_0073645
244 Ga0501033_0582288
245 Ga0501034_0010350
246 Ga0501034_0048326
247 Ga0501034_0793173
248 Ga0501034_0821698
249 Ga0501036_1083274
250 Ga0501037_0007154
251 Ga0501038_0040931
252 Ga0501040_0486249
253 Ga0501047_0725721
254 Ga0501067_0663902
255 Ga0501070_0018774
256 Ga0501070_0240228
257 Ga0501071_0186455
258 Ga0501072_0112484
259 Ga0501072_0562144
260 Ga0501073_0874338
261 Ga0501074_0218936
262 Ga0501074_1142338
263 Ga0501075_0345610
264 Ga0501076_0377084
265 Ga0501079_0943848
266 Ga0501079_1410111
267 Ga0501080_0044828
268 Ga0501080_0249312
269 Ga0501080_0687809
270 Ga0501081_0357643
271 Ga0501081_0534364
272 Ga0501035_0025059
273 Ga0501044_0016372
274 nmdc:mga03683_303636_c1
275 nmdc:mga03n38_176025_c1
276 nmdc:mga03n38_291313_c1
277 nmdc:mga00v17_256831_c1
278 nmdc:mga00v17_3011_c1
279 nmdc:mga00v17_481306_c1
280 nmdc:mga00v17_7210_c1
281 nmdc:mga0yw44_128824_c1
282 nmdc:mga0yw44_157618_c1
283 nmdc:mga06z11_139793_c1
284 nmdc:mga06z11_348114_c1
285 nmdc:mga06z11_642968_c1
286 nmdc:mga06z11_90604_c1
287 nmdc:mga04h51_58161_c1
288 nmdc:mga04h51_90120_c1
289 nmdc:mga0rr50_849690_c1
290 Ga0500583_0059600
291 Ga0500566_0175723
292 Ga0501082_0245560

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wnn-assembly2.cif.gz_B d308a mutant of bacillus circulans t-3040 cycloisomaltooligosaccharide glucanotransferase complexed with isomaltooctaose 0.8864 43 123
1qrk-assembly1.cif.gz_A human factor xiii with strontium bound in the ion site 0.8176 44 126
1qrk-assembly1.cif.gz_B human factor xiii with strontium bound in the ion site 0.8138 44 126
8dhl-assembly1.cif.gz_A tannerella forsythia beta-glucuronidase (l2) 0.8006 36 120
3wnp-assembly1.cif.gz_A d308a, f268v, d469y, a513v, and y515s quintuple mutant of bacillus circulans t-3040 cycloisomaltooligosaccharide glucanotransferase complexed with isomaltoundecaose 0.7992 37 123
ID Description Score Start End Superfamily
4ypjB02 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7763 42 124 2.60.40.10
3wnkA01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7563 7 123 2.60.40.10
3wnoB01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7504 8 123 2.60.40.10
af_M9PDR0_31_119_2.60.40.2950 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7447 43 124 2.60.40.2950
af_Q9VLY7_32_121_2.60.40.2950 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7288 32 127 2.60.40.2950
ID Description Score Start End GO Terms
AF-A0A6I3A9S9-F1-model_v4 Uncharacterized protein 0.9936 1 127
AF-A0A6B1EEM5-F1-model_v4 Uncharacterized protein 0.9911 1 128
AF-A0A6J7KSN7-F1-model_v4 Unannotated protein 0.9905 2 128
AF-A0A6I3A9S9-F1-model_v4 Uncharacterized protein 0.9858 1 127
AF-A0A6B1B6K2-F1-model_v4 Uncharacterized protein 0.9821 1 128

Map