F195057

General Info

Members Datasets Scaffolds Average Seq Length
145 115 145 127

Family's Representative Sequence

Representative Sequence 3300030521|Ga0307511_10097622|Ga0307511_100976221
Length 144
Sequence MTPNERTVLVSNVGGAVDGSAEPERLNQEGFAGFAERAGDGTPVVMLNLLSFKPDGGRERYGEYGDAVAPLLEKVGGRIVFAGEPAAALLGAGSWDLVALVEYPTRQAFLEMIGSAEYQAIGHLRTEALAKGELHPMDPAEPTP

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
5 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
6 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
14 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
17 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
18 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
22 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
23 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
24 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
25 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
26 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
27 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
28 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
46 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
47 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
48 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
49 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
50 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
51 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
52 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
53 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
54 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
55 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
56 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
57 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
58 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
59 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
60 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
61 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
62 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
63 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
64 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
65 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
66 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
67 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
68 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
69 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
70 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
71 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
72 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
73 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
74 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
75 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
76 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
77 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
78 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
79 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
80 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
81 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
82 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
83 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
84 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
85 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
86 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
87 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
88 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
89 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
90 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
91 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
92 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
99 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
100 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
105 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
106 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
107 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
108 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
111 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
112 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
113 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
114 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
115 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.38
Nodule 0
Rhizoplane 6.9
Rhizosphere 89.66
Stem 0
Stem Tuber 0
Unclassified 2.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100019311 3300005329 Bacteria 6054
2 Ga0070691_10344975 3300005341 Bacteria 825
3 Ga0070714_100376958 3300005435 Bacteria 1337
4 Ga0070710_10972366 3300005437 Bacteria 617
5 Ga0070678_100392260 3300005456 Bacteria 1204
6 Ga0070662_100000002 3300005457 Bacteria 253208
7 Ga0070684_100497760 3300005535 Bacteria 1129
8 Ga0068853_100000161 3300005539 Bacteria 45752
9 Ga0068853_100211032 3300005539 Bacteria 1770
10 Ga0070693_100000470 3300005547 Bacteria 18108
11 Ga0070665_100004949 3300005548 Bacteria 13812
12 Ga0068854_100000196 3300005578 Bacteria 40793
13 Ga0068856_100002958 3300005614 Bacteria 17417
14 Ga0068851_10000167 3300005834 Bacteria 33576
15 Ga0068863_100000181 3300005841 Bacteria 67076
16 Ga0068858_100000009 3300005842 Bacteria 237748
17 Ga0068858_100000508 3300005842 Bacteria 40801
18 Ga0075364_10466343 3300006051 Bacteria 863
19 Ga0070712_100003333 3300006175 Bacteria 9867
20 Ga0097621_100448460 3300006237 Unclassified 1162
21 Ga0105245_10000020 3300009098 Bacteria 181774
22 Ga0105245_10000179 3300009098 Bacteria 60347
23 Ga0105243_12336696 3300009148 Unclassified 572
24 Ga0105239_10605380 3300010375 Bacteria 1250
25 Ga0105239_12876468 3300010375 Bacteria 562
26 Ga0157370_10058852 3300013104 Bacteria 3652
27 Ga0157374_10001066 3300013296 Bacteria 23793
28 Ga0157374_10035967 3300013296 Bacteria 4534
29 Ga0157374_10131616 3300013296 Bacteria 2421
30 Ga0157375_10003054 3300013308 Bacteria 14531
31 Ga0157375_10019371 3300013308 Bacteria 6188
32 Ga0157380_10000236 3300014326 Bacteria 33220
33 Ga0157376_10693769 3300014969 Unclassified 1022
34 Ga0163161_10116285 3300017792 Bacteria 2005
35 Ga0207656_10000792 3300025321 Bacteria 10332
36 Ga0207654_10020054 3300025911 Bacteria 3537
37 Ga0207693_10006264 3300025915 Bacteria 9868
38 Ga0207687_10000013 3300025927 Bacteria 299826
39 Ga0207687_10001379 3300025927 Bacteria 16587
40 Ga0207664_11275591 3300025929 Bacteria 654
41 Ga0207706_10000001 3300025933 Bacteria 423014
42 Ga0207709_11434568 3300025935 Unclassified 572
43 Ga0207661_10030831 3300025944 Bacteria 4134
44 Ga0207640_10000153 3300025981 Bacteria 50142
45 Ga0207703_10000023 3300026035 Bacteria 222018
46 Ga0207703_10000385 3300026035 Bacteria 47298
47 Ga0207639_10007443 3300026041 Bacteria 7466
48 Ga0207702_10014111 3300026078 Bacteria 6635
49 Ga0207702_10382443 3300026078 Bacteria 1354
50 Ga0207641_10000349 3300026088 Bacteria 55251
51 Ga0207675_100193783 3300026118 Bacteria 1950
52 Ga0207683_10846481 3300026121 Bacteria 849
53 Ga0268266_10000047 3300028379 Bacteria 310996
54 Ga0268266_10001389 3300028379 Bacteria 29082
55 Ga0268266_11076123 3300028379 Bacteria 778
56 Ga0268264_10001811 3300028381 Bacteria 19534
57 Ga0265337_1000007 3300028556 Bacteria 98412
58 Ga0265326_10000019 3300028558 Bacteria 137370
59 Ga0265318_10214142 3300028577 Bacteria 704
60 Ga0265322_10000011 3300028654 Bacteria 167597
61 Ga0265336_10018161 3300028666 Bacteria 2282
62 Ga0265338_10273525 3300028800 Bacteria 1237
63 Ga0265324_10000517 3300029957 Bacteria 26580
64 Ga0307511_10097622 3300030521 Bacteria 1950
65 Ga0265328_10060323 3300031239 Bacteria 1392
66 Ga0265320_10000011 3300031240 Bacteria 249534
67 Ga0265329_10013933 3300031242 Bacteria 2852
68 Ga0265331_10001713 3300031250 Bacteria 15806
69 Ga0265327_10000015 3300031251 Bacteria 496677
70 Ga0265314_10000513 3300031711 Bacteria 49998
71 Ga0265342_10355286 3300031712 Bacteria 762
72 Ga0451853_0761983 3300041512 Bacteria 2026
73 Ga0466967_0000002 3300045976 Bacteria 219994
74 Ga0495603_0001639 3300046455 Bacteria 13148
75 Ga0495629_0053242 3300046459 Bacteria 2832
76 Ga0495641_0000105 3300046461 Bacteria 59170
77 Ga0495641_0030839 3300046461 Bacteria 2566
78 Ga0495653_0210036 3300046463 Unclassified 1315
79 Ga0495582_0000001 3300046473 Bacteria 252434
80 Ga0495594_0292630 3300046499 Bacteria 928
81 Ga0495608_0010033 3300046511 Bacteria 6608
82 Ga0495608_0011845 3300046511 Bacteria 6068
83 Ga0495620_0002332 3300046515 Bacteria 11009
84 Ga0495628_0118604 3300046516 Bacteria 2031
85 Ga0495630_0043181 3300046517 Bacteria 3367
86 Ga0495630_0202366 3300046517 Bacteria 1515
87 Ga0495630_0596982 3300046517 Unclassified 846
88 Ga0495643_0475214 3300046522 Bacteria 541
89 Ga0495644_0002694 3300046523 Bacteria 7063
90 Ga0495586_0000630 3300046535 Bacteria 20301
91 Ga0495587_0026580 3300046536 Bacteria 3529
92 Ga0495598_0000128 3300046537 Bacteria 12760
93 Ga0495645_0147754 3300046543 Bacteria 1635
94 Ga0495667_0298130 3300046559 Unclassified 1021
95 Ga0495634_0219862 3300046642 Bacteria 1173
96 Ga0495599_0001017 3300046678 Bacteria 15763
97 Ga0495646_0199086 3300046680 Bacteria 1092
98 Ga0495646_0613387 3300046680 Bacteria 552
99 Ga0495647_0000017 3300046681 Bacteria 83387
100 Ga0495658_0000002 3300046683 Bacteria 309651
101 Ga0495624_0000060 3300046690 Bacteria 69512
102 Ga0495624_0220076 3300046690 Unclassified 1151
103 Ga0495670_0073045 3300046691 Bacteria 1738
104 Ga0495649_0006849 3300046694 Bacteria 7054
105 Ga0495674_0124200 3300047319 Unclassified 2179
106 Ga0495674_1213721 3300047319 Bacteria 569
107 Ga0495676_0000106 3300047321 Bacteria 62878
108 Ga0495680_0001698 3300047322 Bacteria 23391
109 Ga0495680_0049417 3300047322 Bacteria 3294
110 Ga0495679_008196 3300047446 Bacteria 4273
111 Ga0495679_177529 3300047446 Unclassified 565
112 Ga0495686_0110761 3300047472 Unclassified 1646
113 Ga0496108_0000001 3300048911 Bacteria 919044
114 Ga0496108_0000397 3300048911 Bacteria 35950
115 Ga0496109_0000004 3300048912 Bacteria 404818
116 Ga0496109_0000803 3300048912 Bacteria 26180
117 Ga0496110_0000613 3300048913 Bacteria 24568
118 Ga0496111_0000044 3300048914 Bacteria 49014
119 Ga0496111_0147748 3300048914 Bacteria 1743
120 Ga0496112_0000006 3300048915 Bacteria 365227
121 Ga0496113_0105398 3300048916 Bacteria 2189
122 Ga0496114_0020152 3300048917 Bacteria 5411
123 Ga0496125_0085924 3300048928 Bacteria 2382
124 Ga0501038_0766558 3300049574 Unclassified 719
125 Ga0501039_0374053 3300049575 Bacteria 1119
126 Ga0501040_0062957 3300049576 Bacteria 2552
127 Ga0501042_0254648 3300049578 Bacteria 1267
128 Ga0501070_0616420 3300049586 Bacteria 864
129 Ga0501071_0606839 3300049587 Bacteria 841
130 Ga0501072_0262301 3300049588 Bacteria 1375
131 Ga0501072_0409860 3300049588 Bacteria 1075
132 Ga0501075_0623474 3300049591 Bacteria 822
133 Ga0501076_0794081 3300049592 Unclassified 781
134 Ga0501076_1679928 3300049592 Bacteria 521
135 Ga0501044_1012160 3300049823 Bacteria 702
136 Ga0501045_0696648 3300049824 Bacteria 750
137 Ga0501045_0754476 3300049824 Unclassified 717
138 Ga0495601_0000035 3300053077 Bacteria 92903
139 Ga0495612_0000067 3300053078 Bacteria 47307
140 Ga0495612_0002245 3300053078 Bacteria 7943
141 Ga0495595_0099281 3300053084 Unclassified 1404
142 Ga0495619_0000008 3300053085 Bacteria 305999
143 Ga0495619_0000096 3300053085 Bacteria 66203
144 Ga0495619_0011670 3300053085 Bacteria 5535
145 Ga0500614_001234 3300053123 Bacteria 6228

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_10003054 Ga0157375_100030545 118
2 3300046499 Ga0495594_0292630 Ga0495594_0292630_152_511 118
3 3300046537 Ga0495598_0000128 Ga0495598_0000128_1597_1959 118
4 3300053084 Ga0495595_0099281 Ga0495595_0099281_105_620 119
5 3300005456 Ga0070678_100392260 Ga0070678_1003922602 122
6 3300005548 Ga0070665_100004949 Ga0070665_1000049495 122
7 3300005578 Ga0068854_100000196 Ga0068854_1000001964 122
8 3300005834 Ga0068851_10000167 Ga0068851_100001674 122
9 3300006175 Ga0070712_100003333 Ga0070712_10000333311 122
10 3300010375 Ga0105239_10605380 Ga0105239_106053802 122
11 3300025321 Ga0207656_10000792 Ga0207656_100007923 122
12 3300025915 Ga0207693_10006264 Ga0207693_1000626410 122
13 3300025981 Ga0207640_10000153 Ga0207640_1000015341 122
14 3300026121 Ga0207683_10846481 Ga0207683_108464812 122
15 3300028379 Ga0268266_10001389 Ga0268266_1000138922 122
16 3300028381 Ga0268264_10001811 Ga0268264_100018119 122
17 3300045976 Ga0466967_0000002 Ga0466967_0000002_92623_92991 122
18 3300047446 Ga0495679_177529 Ga0495679_177529_154_525 122
19 3300048913 Ga0496110_0000613 Ga0496110_0000613_20615_20983 122
20 3300048914 Ga0496111_0000044 Ga0496111_0000044_2726_3094 122
21 3300053085 Ga0495619_0000096 Ga0495619_0000096_10014_10394 122
22 3300013296 Ga0157374_10035967 Ga0157374_100359675 123
23 3300025911 Ga0207654_10020054 Ga0207654_100200544 123
24 3300005437 Ga0070710_10972366 Ga0070710_109723662 124
25 3300005842 Ga0068858_100000508 Ga0068858_10000050824 124
26 3300013104 Ga0157370_10058852 Ga0157370_100588523 124
27 3300026035 Ga0207703_10000385 Ga0207703_1000038530 124
28 3300028556 Ga0265337_1000007 Ga0265337_100000794 124
29 3300028558 Ga0265326_10000019 Ga0265326_1000001992 124
30 3300028577 Ga0265318_10214142 Ga0265318_102141422 124
31 3300028654 Ga0265322_10000011 Ga0265322_1000001192 124
32 3300028666 Ga0265336_10018161 Ga0265336_100181612 124
33 3300028800 Ga0265338_10273525 Ga0265338_102735252 124
34 3300029957 Ga0265324_10000517 Ga0265324_100005179 124
35 3300031239 Ga0265328_10060323 Ga0265328_100603232 124
36 3300031240 Ga0265320_10000011 Ga0265320_1000001192 124
37 3300031242 Ga0265329_10013933 Ga0265329_100139333 124
38 3300031250 Ga0265331_10001713 Ga0265331_100017135 124
39 3300031251 Ga0265327_10000015 Ga0265327_10000015200 124
40 3300031711 Ga0265314_10000513 Ga0265314_1000051327 124
41 3300031712 Ga0265342_10355286 Ga0265342_103552862 124
42 3300046511 Ga0495608_0011845 Ga0495608_0011845_5025_5399 124
43 3300046559 Ga0495667_0298130 Ga0495667_0298130_309_683 124
44 3300047319 Ga0495674_1213721 Ga0495674_1213721_176_550 124
45 3300048911 Ga0496108_0000397 Ga0496108_0000397_23638_24012 124
46 3300048912 Ga0496109_0000803 Ga0496109_0000803_17652_18026 124
47 3300053085 Ga0495619_0000008 Ga0495619_0000008_162841_163215 124
48 3300046463 Ga0495653_0210036 Ga0495653_0210036_617_997 125
49 3300046517 Ga0495630_0596982 Ga0495630_0596982_402_785 125
50 3300046680 Ga0495646_0199086 Ga0495646_0199086_587_967 125
51 3300047319 Ga0495674_0124200 Ga0495674_0124200_287_667 125
52 3300047322 Ga0495680_0049417 Ga0495680_0049417_1347_1748 125
53 3300053078 Ga0495612_0000067 Ga0495612_0000067_19209_19589 125
54 3300005341 Ga0070691_10344975 Ga0070691_103449752 126
55 3300005547 Ga0070693_100000470 Ga0070693_10000047020 126
56 3300046536 Ga0495587_0026580 Ga0495587_0026580_367_750 126
57 3300048915 Ga0496112_0000006 Ga0496112_0000006_249013_249396 126
58 3300049574 Ga0501038_0766558 Ga0501038_0766558_201_584 126
59 3300049575 Ga0501039_0374053 Ga0501039_0374053_686_1069 126
60 3300049576 Ga0501040_0062957 Ga0501040_0062957_1357_1740 126
61 3300049578 Ga0501042_0254648 Ga0501042_0254648_360_743 126
62 3300049588 Ga0501072_0262301 Ga0501072_0262301_505_888 126
63 3300049592 Ga0501076_0794081 Ga0501076_0794081_214_597 126
64 3300049824 Ga0501045_0696648 Ga0501045_0696648_263_646 126
65 3300005329 Ga0070683_100019311 Ga0070683_1000193117 127
66 3300005435 Ga0070714_100376958 Ga0070714_1003769581 127
67 3300005457 Ga0070662_100000002 Ga0070662_100000002198 127
68 3300005535 Ga0070684_100497760 Ga0070684_1004977602 127
69 3300005539 Ga0068853_100000161 Ga0068853_10000016144 127
70 3300005539 Ga0068853_100211032 Ga0068853_1002110323 127
71 3300005614 Ga0068856_100002958 Ga0068856_1000029587 127
72 3300005841 Ga0068863_100000181 Ga0068863_10000018147 127
73 3300005842 Ga0068858_100000009 Ga0068858_100000009100 127
74 3300006051 Ga0075364_10466343 Ga0075364_104663432 127
75 3300006237 Ga0097621_100448460 Ga0097621_1004484602 127
76 3300009098 Ga0105245_10000020 Ga0105245_1000002082 127
77 3300009098 Ga0105245_10000179 Ga0105245_100001794 127
78 3300009148 Ga0105243_12336696 Ga0105243_123366961 127
79 3300010375 Ga0105239_12876468 Ga0105239_128764681 127
80 3300013296 Ga0157374_10001066 Ga0157374_1000106613 127
81 3300013296 Ga0157374_10131616 Ga0157374_101316162 127
82 3300013308 Ga0157375_10019371 Ga0157375_100193716 127
83 3300014326 Ga0157380_10000236 Ga0157380_1000023634 127
84 3300014969 Ga0157376_10693769 Ga0157376_106937692 127
85 3300017792 Ga0163161_10116285 Ga0163161_101162853 127
86 3300025927 Ga0207687_10000013 Ga0207687_10000013124 127
87 3300025927 Ga0207687_10001379 Ga0207687_100013799 127
88 3300025929 Ga0207664_11275591 Ga0207664_112755911 127
89 3300025933 Ga0207706_10000001 Ga0207706_10000001379 127
90 3300025935 Ga0207709_11434568 Ga0207709_114345682 127
91 3300025944 Ga0207661_10030831 Ga0207661_100308312 127
92 3300026035 Ga0207703_10000023 Ga0207703_100000238 127
93 3300026041 Ga0207639_10007443 Ga0207639_100074436 127
94 3300026078 Ga0207702_10014111 Ga0207702_100141112 127
95 3300026078 Ga0207702_10382443 Ga0207702_103824432 127
96 3300026088 Ga0207641_10000349 Ga0207641_1000034911 127
97 3300026118 Ga0207675_100193783 Ga0207675_1001937832 127
98 3300028379 Ga0268266_10000047 Ga0268266_1000004798 127
99 3300028379 Ga0268266_11076123 Ga0268266_110761232 127
100 3300030521 Ga0307511_10097622 Ga0307511_100976221 127
101 3300041512 Ga0451853_0761983 Ga0451853_0761983_648_1034 127
102 3300046455 Ga0495603_0001639 Ga0495603_0001639_8660_9046 127
103 3300046459 Ga0495629_0053242 Ga0495629_0053242_323_709 127
104 3300046461 Ga0495641_0000105 Ga0495641_0000105_52852_53238 127
105 3300046461 Ga0495641_0030839 Ga0495641_0030839_942_1328 127
106 3300046473 Ga0495582_0000001 Ga0495582_0000001_45653_46039 127
107 3300046511 Ga0495608_0010033 Ga0495608_0010033_5590_5976 127
108 3300046515 Ga0495620_0002332 Ga0495620_0002332_10319_10711 127
109 3300046516 Ga0495628_0118604 Ga0495628_0118604_872_1258 127
110 3300046517 Ga0495630_0043181 Ga0495630_0043181_1549_1935 127
111 3300046517 Ga0495630_0202366 Ga0495630_0202366_957_1343 127
112 3300046522 Ga0495643_0475214 Ga0495643_0475214_29_415 127
113 3300046523 Ga0495644_0002694 Ga0495644_0002694_4150_4536 127
114 3300046535 Ga0495586_0000630 Ga0495586_0000630_8400_8786 127
115 3300046543 Ga0495645_0147754 Ga0495645_0147754_991_1377 127
116 3300046642 Ga0495634_0219862 Ga0495634_0219862_375_761 127
117 3300046678 Ga0495599_0001017 Ga0495599_0001017_3558_3944 127
118 3300046680 Ga0495646_0613387 Ga0495646_0613387_44_430 127
119 3300046681 Ga0495647_0000017 Ga0495647_0000017_58185_58571 127
120 3300046683 Ga0495658_0000002 Ga0495658_0000002_169259_169645 127
121 3300046690 Ga0495624_0000060 Ga0495624_0000060_3378_3764 127
122 3300046690 Ga0495624_0220076 Ga0495624_0220076_355_741 127
123 3300046691 Ga0495670_0073045 Ga0495670_0073045_573_965 127
124 3300046694 Ga0495649_0006849 Ga0495649_0006849_6243_6629 127
125 3300047321 Ga0495676_0000106 Ga0495676_0000106_28392_28778 127
126 3300047322 Ga0495680_0001698 Ga0495680_0001698_14257_14643 127
127 3300047446 Ga0495679_008196 Ga0495679_008196_1967_2353 127
128 3300047472 Ga0495686_0110761 Ga0495686_0110761_644_1036 127
129 3300048911 Ga0496108_0000001 Ga0496108_0000001_764110_764517 127
130 3300048912 Ga0496109_0000004 Ga0496109_0000004_17921_18328 127
131 3300048914 Ga0496111_0147748 Ga0496111_0147748_31_417 127
132 3300048916 Ga0496113_0105398 Ga0496113_0105398_980_1363 127
133 3300048917 Ga0496114_0020152 Ga0496114_0020152_2550_2936 127
134 3300048928 Ga0496125_0085924 Ga0496125_0085924_441_848 127
135 3300049586 Ga0501070_0616420 Ga0501070_0616420_104_490 127
136 3300049587 Ga0501071_0606839 Ga0501071_0606839_397_786 127
137 3300049588 Ga0501072_0409860 Ga0501072_0409860_479_880 127
138 3300049591 Ga0501075_0623474 Ga0501075_0623474_345_731 127
139 3300049592 Ga0501076_1679928 Ga0501076_1679928_110_502 127
140 3300049823 Ga0501044_1012160 Ga0501044_1012160_118_504 127
141 3300049824 Ga0501045_0754476 Ga0501045_0754476_104_505 127
142 3300053077 Ga0495601_0000035 Ga0495601_0000035_27589_27975 127
143 3300053078 Ga0495612_0002245 Ga0495612_0002245_6764_7150 127
144 3300053085 Ga0495619_0011670 Ga0495619_0011670_2925_3311 127
145 3300053123 Ga0500614_001234 Ga0500614_001234_5239_5625 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07045

DUF1330

Domain of unknown function (DUF1330)

56

134

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dca-assembly2.cif.gz_D crystal structure of the rpa0582- protein of unknown function from rhodopseudomonas palustris- a structural genomics target 0.8808 9 126
3lo3-assembly2.cif.gz_C the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. 0.8625 24 122
3lo3-assembly2.cif.gz_C the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. 0.8543 24 122
3hhl-assembly2.cif.gz_C crystal structure of methylated rpa0582 protein 0.8274 1 125
2fiu-assembly1.cif.gz_B crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens 0.8194 26 121
ID Description Score Start End Superfamily
3lo3U00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8557 24 122 3.30.70.100
3lo3U00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8475 24 122 3.30.70.100
2fiuB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8229 26 124 3.30.70.100
2fiuB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8075 26 124 3.30.70.100
3hhlC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7971 9 125 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A661F1T0-F1-model_v4 DUF1330 domain-containing protein 0.9649 26 124
AF-A0A800JZD2-F1-model_v4 DUF1330 domain-containing protein 0.9626 23 120
AF-A0A0E3QDK2-F1-model_v4 DUF1330 domain-containing protein 0.9565 31 124
AF-A0A0F2QYY0-F1-model_v4 DUF1330 domain-containing protein 0.9551 23 125
AF-A0A661F1T0-F1-model_v4 DUF1330 domain-containing protein 0.9463 26 124

Feature Viewer

pLDDT pTM Quality
86.64 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map