F193248

General Info

Members Datasets Scaffolds Average Seq Length
144 112 288 200

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2954749733|2954758851
Length 198
Sequence VINCTLKKSPEPSNTEALAQVVGDWLAENAGVEVEYVRAVDLDIHPGVVSEAVDDGDDWPAVHAKLLQAQILVIASPTWLGRPSSVAQRVLERMDAMLSETDDDRPVAYNRVAGVVVTGNEDGAHHVISEINGALCDIGYTVPGQSWTYWHLGPGPGPDYLDDGRGHDWAHKTGRAMAANLLGTARALAANPLGAPPQ

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
39 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
41 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
42 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
43 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
44 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
45 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
46 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
47 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
48 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
49 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
50 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
51 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
52 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
53 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
54 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
55 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
56 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
57 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
58 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
59 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
60 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
61 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
62 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
63 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
64 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
65 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
66 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
78 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
80 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
81 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
82 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
84 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
85 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
86 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
87 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
88 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
89 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
90 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
91 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
92 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
93 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
94 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
95 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
96 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
97 2808606448 Streptomyces sp. 193411 Isolate Unclassified
98 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
99 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
100 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
101 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
102 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
103 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
104 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
105 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
106 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
107 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
108 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
109 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
110 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
111 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
112 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.42
Metatranscriptomes 0
Isolates 14.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.64
Nodule 0
Rhizoplane 2.78
Rhizosphere 86.11
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10076969 3300001979 Bacteria 881
2 JGI25406J46586_10033339 3300003203 Bacteria 1902
3 JGI25407J50210_10001377 3300003373 Bacteria 5510
4 JGI25407J50210_10004626 3300003373 Bacteria 3350
5 JGI25407J50210_10044297 3300003373 Bacteria 1136
6 Ga0070658_10219894 3300005327 Bacteria 1606
7 Ga0070683_100117867 3300005329 Bacteria 2507
8 Ga0070683_100452053 3300005329 Bacteria 1226
9 Ga0070660_100053365 3300005339 Bacteria 3118
10 Ga0070661_100796650 3300005344 Bacteria 775
11 Ga0070659_100501731 3300005366 Bacteria 1034
12 Ga0070679_100001808 3300005530 Bacteria 19287
13 Ga0068853_100109211 3300005539 Bacteria 2455
14 Ga0070665_100093297 3300005548 Bacteria 3015
15 Ga0068855_100052916 3300005563 Bacteria 4778
16 Ga0068856_100644145 3300005614 Bacteria 1080
17 Ga0068852_100013213 3300005616 Bacteria 6310
18 Ga0081538_10000197 3300005981 Bacteria 66585
19 Ga0081538_10000433 3300005981 Bacteria 47051
20 Ga0081538_10010686 3300005981 Bacteria 7513
21 Ga0081538_10051798 3300005981 Bacteria 2460
22 Ga0081539_10000079 3300005985 Bacteria 223413
23 Ga0081539_10004791 3300005985 Bacteria 14567
24 Ga0075368_10019404 3300006042 Bacteria 2566
25 Ga0075363_100162280 3300006048 Bacteria 1266
26 Ga0075363_100216054 3300006048 Bacteria 1098
27 Ga0075364_10073891 3300006051 Bacteria 2248
28 Ga0075367_10084247 3300006178 Bacteria 1927
29 Ga0105240_10031475 3300009093 Bacteria 6881
30 Ga0111539_10188519 3300009094 Bacteria 2407
31 Ga0105241_10012421 3300009174 Bacteria 6242
32 Ga0105238_10020469 3300009551 Bacteria 6735
33 Ga0105028_102898 3300009993 Bacteria 1798
34 Ga0157374_10265954 3300013296 Bacteria 1690
35 Ga0207647_10014145 3300025904 Bacteria 5510
36 Ga0207647_10014414 3300025904 Bacteria 5450
37 Ga0207705_10052878 3300025909 Bacteria 2925
38 Ga0207695_10016102 3300025913 Bacteria 8771
39 Ga0207671_10005358 3300025914 Bacteria 11864
40 Ga0207657_10049662 3300025919 Bacteria 3654
41 Ga0207652_10074285 3300025921 Bacteria 2960
42 Ga0207694_10024726 3300025924 Bacteria 4562
43 Ga0207690_10854585 3300025932 Bacteria 753
44 Ga0207667_10046401 3300025949 Bacteria 4600
45 Ga0207702_10220554 3300026078 Bacteria 1767
46 Ga0207698_10343092 3300026142 Bacteria 1408
47 Ga0209813_10035965 3300027866 Bacteria 1485
48 Ga0268266_10043015 3300028379 Bacteria 3860
49 Ga0307405_10784937 3300031731 Bacteria 797
50 Ga0307410_10014479 3300031852 Bacteria 4642
51 Ga0307410_10266935 3300031852 Bacteria 1337
52 Ga0307406_10418413 3300031901 Bacteria 1067
53 Ga0307412_10224647 3300031911 Bacteria 1442
54 Ga0307409_100044804 3300031995 Bacteria 3335
55 Ga0307409_100377710 3300031995 Bacteria 1346
56 Ga0307416_100039171 3300032002 Bacteria 3667
57 Ga0307416_100134466 3300032002 Bacteria 2234
58 Ga0307416_101779217 3300032002 Bacteria 720
59 Ga0307411_10071356 3300032005 Bacteria 2354
60 Ga0451853_0806706 3300041512 Bacteria 686
61 Ga0451853_0842868 3300041512 Bacteria 4218
62 Ga0466969_0323713 3300044656 Bacteria 697
63 Ga0466972_0087341 3300044658 Bacteria 1481
64 Ga0466965_0003267 3300044683 Bacteria 7092
65 Ga0466965_0102463 3300044683 Bacteria 1465
66 Ga0466961_0022125 3300044693 Bacteria 4091
67 Ga0466961_0065158 3300044693 Bacteria 2315
68 Ga0466963_0099505 3300044694 Bacteria 1989
69 Ga0466971_0047482 3300044719 Bacteria 1930
70 Ga0466970_0036744 3300044765 Bacteria 2595
71 Ga0466970_0100607 3300044765 Bacteria 1574
72 Ga0466960_0013096 3300044901 Bacteria 3515
73 Ga0466959_0004355 3300045049 Bacteria 9469
74 Ga0466959_0051528 3300045049 Bacteria 3018
75 Ga0466958_0032113 3300045836 Bacteria 3122
76 Ga0466958_0136788 3300045836 Bacteria 1541
77 Ga0466967_0034260 3300045976 Bacteria 4308
78 Ga0466967_0048713 3300045976 Bacteria 3702
79 Ga0495603_0013178 3300046455 Bacteria 4997
80 Ga0495594_0002940 3300046499 Bacteria 8837
81 Ga0495588_0070026 3300046674 Bacteria 1823
82 Ga0495676_0006953 3300047321 Bacteria 10385
83 Ga0496108_0008375 3300048911 Bacteria 8389
84 Ga0496108_0252592 3300048911 Bacteria 1534
85 Ga0496109_0180951 3300048912 Bacteria 1980
86 Ga0496113_0212862 3300048916 Bacteria 1539
87 Ga0501033_0043902 3300049570 Bacteria 3328
88 Ga0501033_0482455 3300049570 Bacteria 859
89 Ga0501034_0012842 3300049571 Bacteria 8638
90 Ga0501034_0144118 3300049571 Bacteria 2360
91 Ga0501036_0299956 3300049572 Bacteria 1344
92 Ga0501037_0142406 3300049573 Bacteria 1715
93 Ga0501038_0004012 3300049574 Bacteria 13674
94 Ga0501038_0761138 3300049574 Bacteria 722
95 Ga0501039_0155274 3300049575 Bacteria 1798
96 Ga0501039_0380090 3300049575 Bacteria 1109
97 Ga0501039_0420463 3300049575 Bacteria 1050
98 Ga0501039_0671389 3300049575 Bacteria 811
99 Ga0501040_0249033 3300049576 Bacteria 1267
100 Ga0501041_0222189 3300049577 Bacteria 1185
101 Ga0501042_0091275 3300049578 Bacteria 2186
102 Ga0501043_0142254 3300049579 Bacteria 1878
103 Ga0501043_0523311 3300049579 Bacteria 884
104 Ga0501046_0031503 3300049580 Bacteria 4297
105 Ga0501047_0004615 3300049581 Bacteria 12960
106 Ga0501047_0180301 3300049581 Bacteria 1979
107 Ga0501048_0166373 3300049582 Bacteria 1561
108 Ga0501048_0258657 3300049582 Bacteria 1237
109 Ga0501070_0121748 3300049586 Bacteria 2156
110 Ga0501072_0392622 3300049588 Bacteria 1101
111 Ga0501072_0476738 3300049588 Bacteria 987
112 Ga0501080_0853254 3300049742 Bacteria 796
113 Ga0501044_0021897 3300049823 Bacteria 6816
114 Ga0501045_0506438 3300049824 Bacteria 897
115 nmdc:mga03n38_195476_c1 3300050490 Bacteria 1044
116 nmdc:mga00v17_221363_c1 3300050491 Bacteria 1225
117 nmdc:mga0yw44_105299_c1 3300050492 Bacteria 1802
118 nmdc:mga06z11_80570_c1 3300050494 Bacteria 1746
119 nmdc:mga04h51_6989_c1 3300050495 Bacteria 2958
120 Ga0501084_0383786 3300054114 Bacteria 1187
121 Ga0501082_0280941 3300060353 Bacteria 1449
122 Ga0466962_0008918 3300061719 Bacteria 4806
123 Ga0530510_0154290 3300061734 Bacteria 1696
124 2954758851 2954749733 Bacteria 10366972
125 2547412618 2547132111 Bacteria 8013147
126 2753071226 2751185734 Bacteria 8863695
127 2784592483 2784132148 Bacteria 8627943
128 2809236116 2808606448 Bacteria 8656184
129 2816423169 2816332119 Bacteria 8120218
130 2862286905 2862281513 Bacteria 9621493
131 2870721970 2870721527 Bacteria 9689237
132 2873158380 2873151551 Bacteria 8625867
133 2912715582 2912715099 Bacteria 9460473
134 2919473295 2919468124 Bacteria 9133025
135 2935890930 2935890801 Bacteria 4593001
136 2935892608 2935890801 Bacteria 4593001
137 2954711881 2954711539 Bacteria 10867210
138 2954721814 2954721474 Bacteria 10456478
139 2954740022 2954731030 Bacteria 10243860
140 2954740711 2954740390 Bacteria 10229294
141 2954759721 2954759201 Bacteria 9358192
142 8023625789 8023623736 Bacteria 8593882
143 8054164425 8054160619 Bacteria 7783213
144 8056449437 8056447290 Bacteria 7680491
145 JGI24740J21852_10076969
146 JGI25406J46586_10033339
147 JGI25407J50210_10001377
148 JGI25407J50210_10004626
149 JGI25407J50210_10044297
150 Ga0070658_10219894
151 Ga0070683_100117867
152 Ga0070683_100452053
153 Ga0070660_100053365
154 Ga0070661_100796650
155 Ga0070659_100501731
156 Ga0070679_100001808
157 Ga0068853_100109211
158 Ga0070665_100093297
159 Ga0068855_100052916
160 Ga0068856_100644145
161 Ga0068852_100013213
162 Ga0081538_10000197
163 Ga0081538_10000433
164 Ga0081538_10010686
165 Ga0081538_10051798
166 Ga0081539_10000079
167 Ga0081539_10004791
168 Ga0075368_10019404
169 Ga0075363_100162280
170 Ga0075363_100216054
171 Ga0075364_10073891
172 Ga0075367_10084247
173 Ga0105240_10031475
174 Ga0111539_10188519
175 Ga0105241_10012421
176 Ga0105238_10020469
177 Ga0105028_102898
178 Ga0157374_10265954
179 Ga0207647_10014145
180 Ga0207647_10014414
181 Ga0207705_10052878
182 Ga0207695_10016102
183 Ga0207671_10005358
184 Ga0207657_10049662
185 Ga0207652_10074285
186 Ga0207694_10024726
187 Ga0207690_10854585
188 Ga0207667_10046401
189 Ga0207702_10220554
190 Ga0207698_10343092
191 Ga0209813_10035965
192 Ga0268266_10043015
193 Ga0307405_10784937
194 Ga0307410_10014479
195 Ga0307410_10266935
196 Ga0307406_10418413
197 Ga0307412_10224647
198 Ga0307409_100044804
199 Ga0307409_100377710
200 Ga0307416_100039171
201 Ga0307416_100134466
202 Ga0307416_101779217
203 Ga0307411_10071356
204 Ga0451853_0806706
205 Ga0451853_0842868
206 Ga0466969_0323713
207 Ga0466972_0087341
208 Ga0466965_0003267
209 Ga0466965_0102463
210 Ga0466961_0022125
211 Ga0466961_0065158
212 Ga0466963_0099505
213 Ga0466971_0047482
214 Ga0466970_0036744
215 Ga0466970_0100607
216 Ga0466960_0013096
217 Ga0466959_0004355
218 Ga0466959_0051528
219 Ga0466958_0032113
220 Ga0466958_0136788
221 Ga0466967_0034260
222 Ga0466967_0048713
223 Ga0495603_0013178
224 Ga0495594_0002940
225 Ga0495588_0070026
226 Ga0495676_0006953
227 Ga0496108_0008375
228 Ga0496108_0252592
229 Ga0496109_0180951
230 Ga0496113_0212862
231 Ga0501033_0043902
232 Ga0501033_0482455
233 Ga0501034_0012842
234 Ga0501034_0144118
235 Ga0501036_0299956
236 Ga0501037_0142406
237 Ga0501038_0004012
238 Ga0501038_0761138
239 Ga0501039_0155274
240 Ga0501039_0380090
241 Ga0501039_0420463
242 Ga0501039_0671389
243 Ga0501040_0249033
244 Ga0501041_0222189
245 Ga0501042_0091275
246 Ga0501043_0142254
247 Ga0501043_0523311
248 Ga0501046_0031503
249 Ga0501047_0004615
250 Ga0501047_0180301
251 Ga0501048_0166373
252 Ga0501048_0258657
253 Ga0501070_0121748
254 Ga0501072_0392622
255 Ga0501072_0476738
256 Ga0501080_0853254
257 Ga0501044_0021897
258 Ga0501045_0506438
259 nmdc:mga03n38_195476_c1
260 nmdc:mga00v17_221363_c1
261 nmdc:mga0yw44_105299_c1
262 nmdc:mga06z11_80570_c1
263 nmdc:mga04h51_6989_c1
264 Ga0501084_0383786
265 Ga0501082_0280941
266 Ga0466962_0008918
267 Ga0530510_0154290
268 2954758851
269 2547412618
270 2753071226
271 2784592483
272 2809236116
273 2816423169
274 2862286905
275 2870721970
276 2873158380
277 2912715582
278 2919473295
279 2935890930
280 2935892608
281 2954711881
282 2954721814
283 2954740022
284 2954740711
285 2954759721
286 8023625789
287 8054164425
288 8056449437

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

1

152

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mji-assembly1.cif.gz_A crystal structure of rosb with bound intermediate ohc-rp (8-demethyl-8-formylriboflavin-5'-phosphate) 0.8451 1 196
5mji-assembly1.cif.gz_A crystal structure of rosb with bound intermediate ohc-rp (8-demethyl-8-formylriboflavin-5'-phosphate) 0.8216 1 196
7r2o-assembly1.cif.gz_A crystal structure of a flavodiiron protein s262y mutant in the oxidized state from escherichia coli 0.8173 2 184
7r0f-assembly1.cif.gz_A crystal structure of a flavodiiron protein d52k mutant in the oxidized state from escherichia coli 0.8165 2 184
4d02-assembly1.cif.gz_A the crystallographic structure of flavorubredoxin from escherichia coli 0.8135 2 184
ID Description Score Start End Superfamily
af_I6Y946_20_176_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9606 4 150 3.40.50.360
af_I6Y946_20_176_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8955 4 150 3.40.50.360
2ohhA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8114 1 182 3.40.50.360
4d02A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8075 3 182 3.40.50.360
2ohhA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8007 1 182 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A7W3NFB0-F1-model_v4 Multimeric flavodoxin WrbA 0.9767 1 146 GO:0016491
AF-A0A1H8KQE9-F1-model_v4 NADPH-dependent FMN reductase 0.9754 1 102 GO:0016491
AF-A0A520WW18-F1-model_v4 Flavodoxin family protein 0.975 1 144 GO:0016491
AF-W4VJ65-F1-model_v4 BRAMP protein 0.9741 1 95 GO:0016491
AF-X8DTW9-F1-model_v4 NADPH-dependent FMN reductase family protein 0.9725 1 150 GO:0016491

Map