F190888

General Info

Members Datasets Scaffolds Average Seq Length
144 105 144 118

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_101205063|Ga0070671_1012050632
Length 129
Sequence VLMRMNSPLYRFLTRWLVCSLGLWIAAGFLSNSISYDSRLRVIIVSGLVLAIINVIIKPILVVLSLPAILLTLGLFMIFINGLTVYLASKLYEPLHVTNFWAAMFAGMVIGLVNYLVTAILDDFGDNKA

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
52 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
53 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
54 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
55 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
56 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
57 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
58 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
59 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
60 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
63 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
64 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
65 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
66 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
67 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
68 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
69 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
70 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
71 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
72 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
73 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
74 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
75 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
76 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
77 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
78 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
79 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
80 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
81 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
82 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
83 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
84 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
85 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
86 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
87 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
88 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
89 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
90 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
91 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
92 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
93 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
94 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
95 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
96 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
97 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
98 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
99 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
100 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
101 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
102 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
103 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
104 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
105 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.86
Nodule 0
Rhizoplane 0.69
Rhizosphere 65.28
Stem 0
Stem Tuber 0
Unclassified 4.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10002115 3300001990 Bacteria 7084
2 JGI24735J21928_10001581 3300002067 Bacteria 8083
3 JGI24742J22300_10000010 3300002244 Bacteria 31817
4 rootH1_10148481 3300003316 Unclassified 1739
5 rootH2_10000244 3300003320 Bacteria 697651
6 rootH2_10029137 3300003320 Bacteria 4156
7 rootL2_10219232 3300003322 Bacteria 2376
8 rootH1_10125408 3300003323 Bacteria 2484
9 Ga0070658_10000407 3300005327 Bacteria 37344
10 Ga0070658_10010602 3300005327 Bacteria 7383
11 Ga0070676_10002615 3300005328 Bacteria 9265
12 Ga0068869_101136558 3300005334 Unclassified 684
13 Ga0070682_100000762 3300005337 Bacteria 19113
14 Ga0070682_100976748 3300005337 Bacteria 701
15 Ga0070682_100982641 3300005337 Bacteria 699
16 Ga0070660_100000880 3300005339 Bacteria 20072
17 Ga0070660_100042803 3300005339 Bacteria 3458
18 Ga0070671_101205063 3300005355 Bacteria 666
19 Ga0070659_100999037 3300005366 Bacteria 734
20 Ga0070662_100706429 3300005457 Bacteria 853
21 Ga0070681_10158934 3300005458 Bacteria 2184
22 Ga0070681_10435031 3300005458 Unclassified 1224
23 Ga0070679_100004837 3300005530 Bacteria 12426
24 Ga0070679_100064348 3300005530 Unclassified 3655
25 Ga0070679_101751907 3300005530 Bacteria 569
26 Ga0068855_101034466 3300005563 Unclassified 861
27 Ga0068855_101456312 3300005563 Bacteria 704
28 Ga0068857_100564365 3300005577 Unclassified 1073
29 Ga0068856_100000037 3300005614 Bacteria 120033
30 Ga0081455_10000008 3300005937 Bacteria 256558
31 Ga0070717_10036201 3300006028 Bacteria 4001
32 Ga0075365_10000009 3300006038 Bacteria 111957
33 Ga0075368_10000061 3300006042 Bacteria 26210
34 Ga0075363_100000048 3300006048 Bacteria 23141
35 Ga0075363_100335704 3300006048 Unclassified 881
36 Ga0075364_10074457 3300006051 Bacteria 2239
37 Ga0075364_10392158 3300006051 Bacteria 947
38 Ga0075367_10012978 3300006178 Bacteria 4464
39 Ga0075369_10000010 3300006186 Bacteria 77564
40 Ga0075366_10000001 3300006195 Bacteria 569172
41 Ga0075366_10000200 3300006195 Bacteria 26406
42 Ga0075366_10620813 3300006195 Bacteria 670
43 Ga0097621_100000275 3300006237 Bacteria 34774
44 Ga0075370_10029555 3300006353 Bacteria 3053
45 Ga0068871_100000038 3300006358 Bacteria 69723
46 Ga0105240_12194433 3300009093 Unclassified 573
47 Ga0105245_10000001 3300009098 Bacteria 939270
48 Ga0105245_10000044 3300009098 Bacteria 135878
49 Ga0105245_10076283 3300009098 Bacteria 3053
50 Ga0105243_10254913 3300009148 Unclassified 1568
51 Ga0105033_100150 3300009986 Bacteria 5255
52 Ga0157369_10297635 3300013105 Bacteria 1679
53 Ga0157374_10000058 3300013296 Bacteria 116810
54 Ga0157374_11551277 3300013296 Unclassified 686
55 Ga0157372_10042306 3300013307 Bacteria 5038
56 Ga0157372_10143548 3300013307 Bacteria 2753
57 Ga0157375_12810667 3300013308 Unclassified 582
58 Ga0207645_10017584 3300025907 Bacteria 4715
59 Ga0207705_10000801 3300025909 Bacteria 25821
60 Ga0207705_10986507 3300025909 Bacteria 651
61 Ga0207707_10070576 3300025912 Bacteria 3044
62 Ga0207707_10921389 3300025912 Unclassified 721
63 Ga0207660_10092738 3300025917 Bacteria 2242
64 Ga0207657_10002892 3300025919 Bacteria 18435
65 Ga0207657_10012859 3300025919 Bacteria 8233
66 Ga0207652_10105299 3300025921 Bacteria 2496
67 Ga0207652_10163834 3300025921 Bacteria 1993
68 Ga0207652_10318350 3300025921 Bacteria 1404
69 Ga0207687_10000001 3300025927 Bacteria 1130810
70 Ga0207687_10000004 3300025927 Bacteria 841177
71 Ga0207687_10000033 3300025927 Bacteria 135886
72 Ga0207687_10046276 3300025927 Bacteria 3011
73 Ga0207687_10130511 3300025927 Unclassified 1893
74 Ga0207690_10185180 3300025932 Bacteria 1571
75 Ga0207706_11433467 3300025933 Bacteria 566
76 Ga0207702_10000001 3300026078 Bacteria 895738
77 Ga0209813_10000001 3300027866 Bacteria 280406
78 Ga0265337_1096651 3300028556 Bacteria 804
79 Ga0265334_10099761 3300028573 Unclassified 1052
80 Ga0265338_10582148 3300028800 Unclassified 781
81 Ga0265331_10165330 3300031250 Bacteria 1002
82 Ga0265327_10000025 3300031251 Bacteria 380054
83 Ga0395899_0030864 3300037312 Unclassified 4028
84 Ga0395900_0002337 3300037418 Bacteria 20997
85 Ga0395900_0029116 3300037418 Bacteria 5665
86 Ga0395900_1184172 3300037418 Bacteria 680
87 Ga0395898_0003233 3300037466 Bacteria 18304
88 Ga0395898_0543814 3300037466 Bacteria 1103
89 Ga0395905_0004073 3300037471 Bacteria 15320
90 Ga0395905_0063653 3300037471 Bacteria 3451
91 Ga0395905_1009875 3300037471 Unclassified 735
92 Ga0395901_0061745 3300038443 Bacteria 3899
93 Ga0395901_0306628 3300038443 Bacteria 1645
94 Ga0466960_0370836 3300044901 Bacteria 820
95 Ga0495629_0012394 3300046459 Bacteria 6174
96 Ga0495582_0142586 3300046473 Bacteria 1358
97 Ga0495662_0099498 3300046476 Bacteria 1422
98 Ga0495583_0047273 3300046506 Unclassified 1980
99 Ga0495587_0107505 3300046536 Bacteria 1604
100 Ga0495622_0000191 3300046557 Bacteria 49391
101 Ga0495588_0000236 3300046674 Bacteria 48183
102 Ga0495658_0121440 3300046683 Bacteria 1580
103 Ga0495670_0109237 3300046691 Unclassified 1430
104 Ga0495600_0018341 3300046809 Bacteria 4459
105 Ga0495604_0342943 3300047317 Bacteria 994
106 Ga0495593_0104024 3300047673 Bacteria 1454
107 Ga0495602_0102327 3300048088 Bacteria 2347
108 Ga0495602_0572976 3300048088 Bacteria 780
109 Ga0496105_0090024 3300048908 Bacteria 2535
110 Ga0496126_0197099 3300048929 Unclassified 1703
111 Ga0501290_012641 3300049513 Unclassified 1096
112 Ga0501299_178401 3300049522 Unclassified 553
113 Ga0501071_0615706 3300049587 Bacteria 835
114 Ga0501234_000812 3300049707 Bacteria 4900
115 nmdc:mga03683_1215_c1 3300050489 Bacteria 7610
116 nmdc:mga03683_49_c1 3300050489 Bacteria 11796
117 nmdc:mga03n38_312183_c1 3300050490 Unclassified 847
118 nmdc:mga03n38_78_c1 3300050490 Bacteria 20635
119 nmdc:mga00v17_355123_c1 3300050491 Bacteria 953
120 nmdc:mga00v17_65661_c1 3300050491 Bacteria 2239
121 nmdc:mga0yw44_16177_c1 3300050492 Bacteria 4023
122 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
123 nmdc:mga0k408_118_c2 3300050493 Bacteria 27769
124 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
125 nmdc:mga06z11_15_c1 3300050494 Bacteria 82672
126 nmdc:mga04h51_1_c1 3300050495 Bacteria 273320
127 nmdc:mga07m45_126191_c1 3300050496 Bacteria 1480
128 nmdc:mga07m45_17751_c1 3300050496 Bacteria 3828
129 nmdc:mga0sz30_3_c9 3300050516 Bacteria 81468
130 Ga0500643_000148 3300053087 Bacteria 71560
131 Ga0500644_0059183 3300053088 Bacteria 1343
132 Ga0500583_0001709 3300053092 Bacteria 6417
133 Ga0500566_0000001 3300053094 Bacteria 1101031
134 Ga0500555_090620 3300053103 Bacteria 785
135 Ga0500556_0002599 3300053104 Bacteria 5688
136 Ga0500562_000002 3300053108 Bacteria 977234
137 Ga0500614_000001 3300053123 Bacteria 1274484
138 Ga0500561_0000001 3300053137 Bacteria 957685
139 Ga0500589_053376 3300053147 Bacteria 1871
140 Ga0500603_273783 3300053150 Bacteria 545
141 Ga0500604_0117250 3300053151 Bacteria 888
142 Ga0500649_000011 3300053722 Bacteria 87970
143 Ga0500570_000004 3300053724 Bacteria 133101
144 Ga0500611_002366 3300053727 Bacteria 2245

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10143548 Ga0157372_101435482 88
2 3300044901 Ga0466960_0370836 Ga0466960_0370836_130_501 90
3 3300037471 Ga0395905_1009875 Ga0395905_1009875_406_714 91
4 3300006042 Ga0075368_10000061 Ga0075368_100000615 92
5 3300006048 Ga0075363_100000048 Ga0075363_10000004827 92
6 3300006195 Ga0075366_10620813 Ga0075366_106208132 92
7 3300027866 Ga0209813_10000001 Ga0209813_10000001223 92
8 3300031250 Ga0265331_10165330 Ga0265331_101653303 92
9 3300031251 Ga0265327_10000025 Ga0265327_10000025377 93
10 3300048908 Ga0496105_0090024 Ga0496105_0090024_1093_1464 93
11 3300005337 Ga0070682_100982641 Ga0070682_1009826411 95
12 3300009098 Ga0105245_10076283 Ga0105245_100762833 95
13 3300013307 Ga0157372_10042306 Ga0157372_100423066 95
14 3300025927 Ga0207687_10046276 Ga0207687_100462763 95
15 3300009148 Ga0105243_10254913 Ga0105243_102549133 96
16 3300005337 Ga0070682_100976748 Ga0070682_1009767482 97
17 3300005577 Ga0068857_100564365 Ga0068857_1005643653 97
18 3300037418 Ga0395900_1184172 Ga0395900_1184172_98_460 97
19 3300006038 Ga0075365_10000009 Ga0075365_1000000931 98
20 3300048929 Ga0496126_0197099 Ga0496126_0197099_332_706 98
21 3300050492 nmdc:mga0yw44_2_c1 nmdc:mga0yw44_2_c1_47923_48294 98
22 3300046459 Ga0495629_0012394 Ga0495629_0012394_2295_2669 100
23 3300046473 Ga0495582_0142586 Ga0495582_0142586_148_522 100
24 3300046476 Ga0495662_0099498 Ga0495662_0099498_557_931 100
25 3300046506 Ga0495583_0047273 Ga0495583_0047273_496_834 100
26 3300046536 Ga0495587_0107505 Ga0495587_0107505_436_810 100
27 3300046557 Ga0495622_0000191 Ga0495622_0000191_25909_26283 100
28 3300046683 Ga0495658_0121440 Ga0495658_0121440_1077_1451 100
29 3300046809 Ga0495600_0018341 Ga0495600_0018341_1470_1844 100
30 3300047317 Ga0495604_0342943 Ga0495604_0342943_569_943 100
31 3300047673 Ga0495593_0104024 Ga0495593_0104024_106_480 100
32 3300048088 Ga0495602_0102327 Ga0495602_0102327_988_1362 100
33 3300050496 nmdc:mga07m45_17751_c1 nmdc:mga07m45_17751_c1_168_539 100
34 3300053094 Ga0500566_0000001 Ga0500566_0000001_480722_481096 100
35 3300053103 Ga0500555_090620 Ga0500555_090620_203_541 100
36 3300053150 Ga0500603_273783 Ga0500603_273783_139_513 100
37 3300003316 rootH1_10148481 rootH1_101484813 102
38 3300005614 Ga0068856_100000037 Ga0068856_10000003797 102
39 3300006178 Ga0075367_10012978 Ga0075367_100129784 102
40 3300006353 Ga0075370_10029555 Ga0075370_100295552 102
41 3300026078 Ga0207702_10000001 Ga0207702_10000001522 102
42 3300046674 Ga0495588_0000236 Ga0495588_0000236_17382_17756 102
43 3300049513 Ga0501290_012641 Ga0501290_012641_573_914 102
44 3300049522 Ga0501299_178401 Ga0501299_178401_127_468 102
45 3300050490 nmdc:mga03n38_78_c1 nmdc:mga03n38_78_c1_19222_19593 102
46 3300050494 nmdc:mga06z11_15_c1 nmdc:mga06z11_15_c1_59096_59467 102
47 3300050495 nmdc:mga04h51_1_c1 nmdc:mga04h51_1_c1_206978_207349 102
48 3300050496 nmdc:mga07m45_126191_c1 nmdc:mga07m45_126191_c1_138_509 102
49 3300053123 Ga0500614_000001 Ga0500614_000001_521962_522336 102
50 3300053151 Ga0500604_0117250 Ga0500604_0117250_477_851 102
51 3300053722 Ga0500649_000011 Ga0500649_000011_10588_10962 102
52 3300005339 Ga0070660_100000880 Ga0070660_10000088012 103
53 3300050489 nmdc:mga03683_1215_c1 nmdc:mga03683_1215_c1_7097_7468 103
54 3300046691 Ga0495670_0109237 Ga0495670_0109237_821_1168 104
55 3300053724 Ga0500570_000004 Ga0500570_000004_10591_10938 104
56 3300006048 Ga0075363_100335704 Ga0075363_1003357041 105
57 3300050490 nmdc:mga03n38_312183_c1 nmdc:mga03n38_312183_c1_38_409 105
58 3300005327 Ga0070658_10000407 Ga0070658_1000040725 106
59 3300025909 Ga0207705_10000801 Ga0207705_1000080111 106
60 3300049707 Ga0501234_000812 Ga0501234_000812_4407_4769 109
61 3300053104 Ga0500556_0002599 Ga0500556_0002599_2438_2800 109
62 3300002244 JGI24742J22300_10000010 JGI24742J22300_1000001032 110
63 3300005328 Ga0070676_10002615 Ga0070676_100026151 110
64 3300005458 Ga0070681_10435031 Ga0070681_104350313 110
65 3300005530 Ga0070679_100004837 Ga0070679_1000048377 110
66 3300009093 Ga0105240_12194433 Ga0105240_121944332 110
67 3300013296 Ga0157374_11551277 Ga0157374_115512772 110
68 3300025907 Ga0207645_10017584 Ga0207645_100175841 110
69 3300025912 Ga0207707_10921389 Ga0207707_109213892 110
70 3300025921 Ga0207652_10318350 Ga0207652_103183503 110
71 3300025927 Ga0207687_10130511 Ga0207687_101305112 110
72 3300037418 Ga0395900_0002337 Ga0395900_0002337_16133_16504 110
73 3300037466 Ga0395898_0543814 Ga0395898_0543814_475_846 110
74 3300037471 Ga0395905_0063653 Ga0395905_0063653_2929_3300 110
75 3300038443 Ga0395901_0306628 Ga0395901_0306628_125_496 110
76 3300003320 rootH2_10000244 rootH2_10000244584 111
77 3300005327 Ga0070658_10010602 Ga0070658_100106023 111
78 3300005334 Ga0068869_101136558 Ga0068869_1011365582 111
79 3300005337 Ga0070682_100000762 Ga0070682_1000007627 111
80 3300005339 Ga0070660_100042803 Ga0070660_1000428032 111
81 3300005366 Ga0070659_100999037 Ga0070659_1009990372 111
82 3300005457 Ga0070662_100706429 Ga0070662_1007064292 111
83 3300005458 Ga0070681_10158934 Ga0070681_101589342 111
84 3300005530 Ga0070679_100064348 Ga0070679_1000643483 111
85 3300005563 Ga0068855_101034466 Ga0068855_1010344662 111
86 3300005937 Ga0081455_10000008 Ga0081455_1000000845 111
87 3300006028 Ga0070717_10036201 Ga0070717_100362017 111
88 3300013105 Ga0157369_10297635 Ga0157369_102976353 111
89 3300013308 Ga0157375_12810667 Ga0157375_128106671 111
90 3300025909 Ga0207705_10986507 Ga0207705_109865071 111
91 3300025912 Ga0207707_10070576 Ga0207707_100705764 111
92 3300025917 Ga0207660_10092738 Ga0207660_100927383 111
93 3300025919 Ga0207657_10002892 Ga0207657_1000289212 111
94 3300025919 Ga0207657_10012859 Ga0207657_100128593 111
95 3300025921 Ga0207652_10163834 Ga0207652_101638342 111
96 3300025932 Ga0207690_10185180 Ga0207690_101851802 111
97 3300025933 Ga0207706_11433467 Ga0207706_114334671 111
98 3300028573 Ga0265334_10099761 Ga0265334_100997612 111
99 3300028800 Ga0265338_10582148 Ga0265338_105821482 111
100 3300053088 Ga0500644_0059183 Ga0500644_0059183_207_587 111
101 3300001990 JGI24737J22298_10002115 JGI24737J22298_100021156 112
102 3300002067 JGI24735J21928_10001581 JGI24735J21928_100015813 112
103 3300003320 rootH2_10029137 rootH2_100291373 112
104 3300003322 rootL2_10219232 rootL2_102192323 112
105 3300003323 rootH1_10125408 rootH1_101254082 112
106 3300005355 Ga0070671_101205063 Ga0070671_1012050632 112
107 3300005530 Ga0070679_101751907 Ga0070679_1017519071 112
108 3300005563 Ga0068855_101456312 Ga0068855_1014563122 112
109 3300006051 Ga0075364_10074457 Ga0075364_100744572 112
110 3300006051 Ga0075364_10392158 Ga0075364_103921583 112
111 3300006186 Ga0075369_10000010 Ga0075369_1000001056 112
112 3300006195 Ga0075366_10000001 Ga0075366_10000001611 112
113 3300006195 Ga0075366_10000200 Ga0075366_1000020029 112
114 3300006237 Ga0097621_100000275 Ga0097621_1000002755 112
115 3300006358 Ga0068871_100000038 Ga0068871_10000003835 112
116 3300009098 Ga0105245_10000001 Ga0105245_10000001548 112
117 3300009098 Ga0105245_10000044 Ga0105245_1000004435 112
118 3300009986 Ga0105033_100150 Ga0105033_1001504 112
119 3300013296 Ga0157374_10000058 Ga0157374_1000005886 112
120 3300025921 Ga0207652_10105299 Ga0207652_101052993 112
121 3300025927 Ga0207687_10000001 Ga0207687_10000001110 112
122 3300025927 Ga0207687_10000004 Ga0207687_10000004723 112
123 3300025927 Ga0207687_10000033 Ga0207687_1000003334 112
124 3300028556 Ga0265337_1096651 Ga0265337_10966512 112
125 3300037312 Ga0395899_0030864 Ga0395899_0030864_1546_1920 112
126 3300037418 Ga0395900_0029116 Ga0395900_0029116_4709_5080 112
127 3300037466 Ga0395898_0003233 Ga0395898_0003233_10694_11068 112
128 3300037471 Ga0395905_0004073 Ga0395905_0004073_2583_2957 112
129 3300038443 Ga0395901_0061745 Ga0395901_0061745_749_1123 112
130 3300048088 Ga0495602_0572976 Ga0495602_0572976_373_747 112
131 3300049587 Ga0501071_0615706 Ga0501071_0615706_41_415 112
132 3300050489 nmdc:mga03683_49_c1 nmdc:mga03683_49_c1_6269_6643 112
133 3300050491 nmdc:mga00v17_355123_c1 nmdc:mga00v17_355123_c1_362_733 112
134 3300050491 nmdc:mga00v17_65661_c1 nmdc:mga00v17_65661_c1_187_558 112
135 3300050492 nmdc:mga0yw44_16177_c1 nmdc:mga0yw44_16177_c1_1725_2096 112
136 3300050493 nmdc:mga0k408_118_c2 nmdc:mga0k408_118_c2_24612_24983 112
137 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_520507_520896 112
138 3300050516 nmdc:mga0sz30_3_c9 nmdc:mga0sz30_3_c9_28966_29355 112
139 3300053087 Ga0500643_000148 Ga0500643_000148_45800_46177 112
140 3300053092 Ga0500583_0001709 Ga0500583_0001709_4672_5049 112
141 3300053108 Ga0500562_000002 Ga0500562_000002_740877_741248 112
142 3300053137 Ga0500561_0000001 Ga0500561_0000001_774099_774470 112
143 3300053147 Ga0500589_053376 Ga0500589_053376_978_1355 112
144 3300053727 Ga0500611_002366 Ga0500611_002366_625_1002 112

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04020

Phage_holin_4_2

Mycobacterial 4 TMS phage holin, superfamily IV

10

121

0.94

Feature Viewer

pLDDT pTM Quality
67.35 0.37 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map