F190537

General Info

Members Datasets Scaffolds Average Seq Length
144 103 288 105

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10109915|Ga0065714_101099152
Length 112
Sequence MGNSNFEEIIRRSLEIRKKYHELEMQHHGSEWTVEEDALAYLTDAGLVGRNIMSQQKRWPKSNSQEELEHKLGENIWWLIVLAERSNIDIKKAMEKFLTKTGKMFDLDSTNP

Samples

Sample ID Description Type Environment
1 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
8 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
9 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
10 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
11 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
12 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
13 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
14 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
15 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
16 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
17 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
18 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
19 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
20 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
21 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
22 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
23 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
30 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
31 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
32 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
33 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
34 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
35 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
36 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
37 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
38 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
39 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
40 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
41 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
42 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
43 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
44 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
45 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
46 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
47 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
48 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
49 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
50 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
51 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
52 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
53 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
54 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
55 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
56 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
57 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
58 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
59 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
60 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
61 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
62 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
63 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
64 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
65 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
66 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
67 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
68 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
69 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
70 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
71 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
72 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
73 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
74 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
75 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
76 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
77 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
78 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
79 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
80 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
81 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
82 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
83 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
84 2738541302 Pedobacter sp. CF074 Isolate Unclassified
85 2739367663 Pedobacter sp. YR510 Isolate Unclassified
86 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
87 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
88 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
89 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
90 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
91 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
92 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
93 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
94 2914759650 Rhizosphaericola mali Isolate Rhizosphere
95 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
96 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
97 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
98 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
99 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
100 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
101 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
102 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified
103 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.56
Metatranscriptomes 0.69
Isolates 18.75

Biome Distribution

Category Percentage (%)
Aerial Root 1.39
Bulb 0
Endosphere 6.25
Nodule 0
Rhizoplane 1.39
Rhizosphere 70.14
Stem 0
Stem Tuber 0
Unclassified 3.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10109915 3300005288 Bacteria 1493
2 SwRhRL2b_contig_537508 2162886007 Bacteria 5680
3 Ga0006562J51391_1021827 3300003578 Bacteria 864
4 Ga0065714_10472750 3300005288 Bacteria 539
5 Ga0065704_10002345 3300005289 Bacteria 11247
6 Ga0065704_10071388 3300005289 Bacteria 11360
7 Ga0065704_10076346 3300005289 Bacteria 5156
8 Ga0065704_10293935 3300005289 Bacteria 898
9 Ga0065704_10524439 3300005289 Bacteria 651
10 Ga0065715_10030805 3300005293 Bacteria 1223
11 Ga0065715_10707919 3300005293 Bacteria 641
12 Ga0070682_100075195 3300005337 Bacteria 2172
13 Ga0070665_100583953 3300005548 Bacteria 1130
14 Ga0068858_101770597 3300005842 Bacteria 610
15 Ga0105251_10066930 3300009011 Bacteria 1678
16 Ga0105244_10000057 3300009036 Bacteria 129775
17 Ga0105244_10008298 3300009036 Bacteria 6499
18 Ga0105244_10045674 3300009036 Bacteria 2253
19 Ga0105240_11411611 3300009093 Bacteria 732
20 Ga0105243_10000696 3300009148 Bacteria 32612
21 Ga0105249_10338145 3300009553 Bacteria 1521
22 Ga0157373_10002633 3300013100 Bacteria 13614
23 Ga0157373_10134303 3300013100 Bacteria 1740
24 Ga0157371_10013296 3300013102 Bacteria 6260
25 Ga0157370_10000788 3300013104 Bacteria 39828
26 Ga0157370_10006912 3300013104 Bacteria 12407
27 Ga0157370_10012796 3300013104 Bacteria 8675
28 Ga0157370_10145988 3300013104 Bacteria 2203
29 Ga0157370_10295696 3300013104 Bacteria 1495
30 Ga0157370_10641186 3300013104 Bacteria 971
31 Ga0157370_10696945 3300013104 Bacteria 927
32 Ga0157369_10009222 3300013105 Bacteria 11288
33 Ga0157372_11290047 3300013307 Bacteria 843
34 Ga0157375_10000075 3300013308 Bacteria 102852
35 Ga0157375_10933896 3300013308 Bacteria 1010
36 Ga0182008_10000684 3300014497 Bacteria 24468
37 Ga0182006_1015978 3300015261 Bacteria 3208
38 Ga0163161_10000470 3300017792 Bacteria 33480
39 Ga0163161_10059756 3300017792 Bacteria 2773
40 Ga0163161_10065929 3300017792 Bacteria 2643
41 Ga0163161_10118694 3300017792 Bacteria 1985
42 Ga0163161_10222820 3300017792 Bacteria 1461
43 Ga0209050_1002267 3300025298 Bacteria 17052
44 Ga0207696_1065063 3300025711 Bacteria 1020
45 Ga0207696_1113175 3300025711 Bacteria 734
46 Ga0207655_1000038 3300025728 Bacteria 348340
47 Ga0207655_1001953 3300025728 Bacteria 17608
48 Ga0207655_1003525 3300025728 Bacteria 11597
49 Ga0207713_1243304 3300025735 Bacteria 533
50 Ga0207709_10000890 3300025935 Bacteria 22592
51 Ga0207712_10198375 3300025961 Bacteria 1589
52 Ga0307515_10527694 3300028794 Unclassified 790
53 Ga0316183_1079365 3300030742 Bacteria 35752
54 Ga0316181_1050411 3300030744 Bacteria 1553
55 Ga0307405_10000005 3300031731 Bacteria 376536
56 Ga0307406_10002241 3300031901 Bacteria 10530
57 Ga0307412_10017712 3300031911 Bacteria 4268
58 Ga0307412_11216723 3300031911 Bacteria 675
59 Ga0307409_100161332 3300031995 Bacteria 1961
60 Ga0307414_10000072 3300032004 Bacteria 94883
61 Ga0307414_10009665 3300032004 Bacteria 5552
62 Ga0307414_10009982 3300032004 Bacteria 5482
63 Ga0307414_10157210 3300032004 Bacteria 1801
64 Ga0307414_10734454 3300032004 Bacteria 896
65 Ga0307414_11730802 3300032004 Bacteria 583
66 Ga0307414_12189387 3300032004 Bacteria 516
67 Ga0373935_1076598 3300035692 Unclassified 598
68 Ga0439447_003178 3300041407 Bacteria 5849
69 Ga0451797_0452514 3300041453 Bacteria 555
70 Ga0451843_0123331 3300041509 Bacteria 632
71 Ga0451843_0470909 3300041509 Bacteria 598
72 Ga0451855_0025922 3300041511 Bacteria 1736
73 Ga0439445_0000366 3300042004 Bacteria 9005
74 Ga0495627_017361 3300046453 Bacteria 2446
75 Ga0495591_024594 3300046458 Bacteria 1906
76 Ga0495638_0619522 3300046460 Unclassified 529
77 Ga0495650_0082599 3300046471 Bacteria 1236
78 Ga0495607_0018838 3300046501 Bacteria 4391
79 Ga0495606_0021437 3300046507 Bacteria 4733
80 Ga0495606_0118940 3300046507 Bacteria 1583
81 Ga0495606_0131871 3300046507 Bacteria 1484
82 Ga0495610_0000009 3300046512 Bacteria 554843
83 Ga0495610_0000747 3300046512 Bacteria 30695
84 Ga0495663_0000065 3300046525 Bacteria 49401
85 Ga0495654_0301584 3300046530 Bacteria 654
86 Ga0495609_0000063 3300046538 Bacteria 135584
87 Ga0495625_0094282 3300046660 Bacteria 2066
88 Ga0495671_0145732 3300046692 Bacteria 1153
89 Ga0495660_0058232 3300046810 Bacteria 2082
90 Ga0495672_0312809 3300047320 Bacteria 740
91 Ga0495686_0000125 3300047472 Bacteria 158834
92 Ga0496115_0865576 3300048918 Bacteria 699
93 Ga0496116_0000024 3300048919 Bacteria 471420
94 Ga0496117_0321775 3300048920 Unclassified 810
95 Ga0496121_0100413 3300048924 Bacteria 2234
96 Ga0496121_0129577 3300048924 Bacteria 1891
97 Ga0496122_0001333 3300048925 Bacteria 40382
98 Ga0496123_0471664 3300048926 Bacteria 554
99 Ga0496124_0010428 3300048927 Bacteria 9406
100 Ga0496124_0071050 3300048927 Bacteria 2887
101 Ga0496125_0000018 3300048928 Bacteria 482390
102 Ga0496125_0002600 3300048928 Bacteria 23176
103 Ga0496125_0544317 3300048928 Bacteria 644
104 Ga0496126_0015239 3300048929 Bacteria 7740
105 Ga0496126_0098205 3300048929 Bacteria 2566
106 Ga0501249_000070 3300049679 Bacteria 35806
107 Ga0501225_0000768 3300049705 Bacteria 10067
108 Ga0501241_003708 3300049758 Bacteria 2880
109 Ga0501241_012865 3300049758 Bacteria 1521
110 Ga0500655_005074 3300053133 Unclassified 2370
111 Ga0500658_0000002 3300053134 Bacteria 548440
112 Ga0500559_0012510 3300053136 Bacteria 3605
113 Ga0500559_0020064 3300053136 Bacteria 2825
114 Ga0500590_074733 3300053148 Bacteria 1677
115 Ga0500616_0000890 3300053153 Bacteria 32800
116 Ga0500584_005708 3300053726 Bacteria 5264
117 Ga0500661_011274 3300055283 Bacteria 1618
118 2587678197 2585428045 Bacteria 5203023
119 2587751417 2585428061 Bacteria 3939663
120 2587865404 2585428095 Bacteria 3789702
121 2590602637 2588254255 Bacteria 5014294
122 2590613068 2588254257 Bacteria 5436094
123 2644009095 2643221600 Bacteria 5530138
124 2644363898 2643221665 Bacteria 4699229
125 2738852238 2738541302 Bacteria 5944758
126 2739646018 2739367663 Bacteria 5040914
127 2740002738 2739367857 Bacteria 5433684
128 2740007555 2739367858 Bacteria 5432813
129 2833643267 2833640130 Bacteria 4858325
130 2842088139 2842083920 Bacteria 4857652
131 2842726001 2842722452 Bacteria 6263924
132 2857619612 2857618242 Bacteria 5635925
133 2881249645 2881247448 Bacteria 3717788
134 2904119026 2904113452 Bacteria 7796941
135 2914760789 2914759650 Bacteria 4701441
136 2919194112 2919191525 Bacteria 5765973
137 2928512694 2928510474 Bacteria 4815308
138 2954020307 2954016120 Bacteria 6446024
139 2977270595 2977268062 Bacteria 5243061
140 2984575159 2984572630 Bacteria 4186940
141 2984608612 2984606641 Bacteria 4186971
142 3003234431 3003233435 Bacteria 4458031
143 8007377237 8007375930 Bacteria 4080554
144 8022952204 8022948649 Bacteria 5366783
145 Ga0065714_10109915
146 SwRhRL2b_contig_537508
147 Ga0006562J51391_1021827
148 Ga0065714_10472750
149 Ga0065704_10002345
150 Ga0065704_10071388
151 Ga0065704_10076346
152 Ga0065704_10293935
153 Ga0065704_10524439
154 Ga0065715_10030805
155 Ga0065715_10707919
156 Ga0070682_100075195
157 Ga0070665_100583953
158 Ga0068858_101770597
159 Ga0105251_10066930
160 Ga0105244_10000057
161 Ga0105244_10008298
162 Ga0105244_10045674
163 Ga0105240_11411611
164 Ga0105243_10000696
165 Ga0105249_10338145
166 Ga0157373_10002633
167 Ga0157373_10134303
168 Ga0157371_10013296
169 Ga0157370_10000788
170 Ga0157370_10006912
171 Ga0157370_10012796
172 Ga0157370_10145988
173 Ga0157370_10295696
174 Ga0157370_10641186
175 Ga0157370_10696945
176 Ga0157369_10009222
177 Ga0157372_11290047
178 Ga0157375_10000075
179 Ga0157375_10933896
180 Ga0182008_10000684
181 Ga0182006_1015978
182 Ga0163161_10000470
183 Ga0163161_10059756
184 Ga0163161_10065929
185 Ga0163161_10118694
186 Ga0163161_10222820
187 Ga0209050_1002267
188 Ga0207696_1065063
189 Ga0207696_1113175
190 Ga0207655_1000038
191 Ga0207655_1001953
192 Ga0207655_1003525
193 Ga0207713_1243304
194 Ga0207709_10000890
195 Ga0207712_10198375
196 Ga0307515_10527694
197 Ga0316183_1079365
198 Ga0316181_1050411
199 Ga0307405_10000005
200 Ga0307406_10002241
201 Ga0307412_10017712
202 Ga0307412_11216723
203 Ga0307409_100161332
204 Ga0307414_10000072
205 Ga0307414_10009665
206 Ga0307414_10009982
207 Ga0307414_10157210
208 Ga0307414_10734454
209 Ga0307414_11730802
210 Ga0307414_12189387
211 Ga0373935_1076598
212 Ga0439447_003178
213 Ga0451797_0452514
214 Ga0451843_0123331
215 Ga0451843_0470909
216 Ga0451855_0025922
217 Ga0439445_0000366
218 Ga0495627_017361
219 Ga0495591_024594
220 Ga0495638_0619522
221 Ga0495650_0082599
222 Ga0495607_0018838
223 Ga0495606_0021437
224 Ga0495606_0118940
225 Ga0495606_0131871
226 Ga0495610_0000009
227 Ga0495610_0000747
228 Ga0495663_0000065
229 Ga0495654_0301584
230 Ga0495609_0000063
231 Ga0495625_0094282
232 Ga0495671_0145732
233 Ga0495660_0058232
234 Ga0495672_0312809
235 Ga0495686_0000125
236 Ga0496115_0865576
237 Ga0496116_0000024
238 Ga0496117_0321775
239 Ga0496121_0100413
240 Ga0496121_0129577
241 Ga0496122_0001333
242 Ga0496123_0471664
243 Ga0496124_0010428
244 Ga0496124_0071050
245 Ga0496125_0000018
246 Ga0496125_0002600
247 Ga0496125_0544317
248 Ga0496126_0015239
249 Ga0496126_0098205
250 Ga0501249_000070
251 Ga0501225_0000768
252 Ga0501241_003708
253 Ga0501241_012865
254 Ga0500655_005074
255 Ga0500658_0000002
256 Ga0500559_0012510
257 Ga0500559_0020064
258 Ga0500590_074733
259 Ga0500616_0000890
260 Ga0500584_005708
261 Ga0500661_011274
262 2587678197
263 2587751417
264 2587865404
265 2590602637
266 2590613068
267 2644009095
268 2644363898
269 2738852238
270 2739646018
271 2740002738
272 2740007555
273 2833643267
274 2842088139
275 2842726001
276 2857619612
277 2881249645
278 2904119026
279 2914760789
280 2919194112
281 2928512694
282 2954020307
283 2977270595
284 2984575159
285 2984608612
286 3003234431
287 8007377237
288 8022952204

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zj3-assembly1.cif.gz_Lp cryo-em structure of the highly atypical cytoplasmic ribosome of euglena gracilis 0.8897 35 87
5u4i-assembly1.cif.gz_Z structural basis of co-translational quality control by arfa and rf2 bound to ribosome 0.8875 31 87
7pjw-assembly1.cif.gz_Y structure of the 70s-ef-g-gdp-pi ribosome complex with trnas in hybrid state 2 (h2-ef-g-gdp-pi) 0.8872 32 86
3jbn-assembly1.cif.gz_A3 cryo-electron microscopy reconstruction of the plasmodium falciparum 80s ribosome bound to p-trna 0.8862 32 86
7pjv-assembly1.cif.gz_Y structure of the 70s-ef-g-gdp-pi ribosome complex with trnas in hybrid state 1 (h1-ef-g-gdp-pi) 0.8858 32 84
ID Description Score Start End Superfamily
af_Q6K602_14_99_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.8813 32 83 1.20.1280.290
af_A0A1D6H929_14_99_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.8749 32 83 1.20.1280.290
af_K7U0B5_14_99_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.8715 32 83 1.20.1280.290
af_Q2FYR2_112_393_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8649 34 84 3.40.630.30
af_Q2FYR2_68_400_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8649 34 84 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A519UG66-F1-model_v4 MazG-like protein 0.9977 10 106
AF-A0A519NIE3-F1-model_v4 MazG-like protein 0.9916 6 106
AF-A0A077KXL7-F1-model_v4 deleted 0.9799 7 103
AF-A0A1J4S1M2-F1-model_v4 NTP pyrophosphohydrolase MazG-like domain-containing protein 0.9798 6 105
AF-A0A4R7Q9E9-F1-model_v4 deleted 0.9787 8 105

Map