F188477

General Info

Members Datasets Scaffolds Average Seq Length
143 91 142 177

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100009186|Ga0075436_1000091867
Length 176
Sequence MAQERKGAVTLRGNPLTLAGPEIKAGQPAPDFTAVGTDLKEVRLADGRGKVLVLSSVPSLDTPTCDTETRRFNQEAAGLGEGIEVWTLSMDLPFAQKRWCGAAGIDRVKTFSDFRHRTFGEAYGVRIVDGPIAGVNARAVFVVGKDGKVAHAQYVKEVSAEPDYEAVLSAARAAAR

Samples

Sample ID Description Type Environment
1 2818991459 Paenibacillus sp. 597 Isolate Unclassified
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
42 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
58 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
59 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
60 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
61 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
62 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
63 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
64 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
70 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
71 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
72 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
73 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
76 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
77 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
78 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
82 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
83 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
84 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
85 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
86 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
87 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
89 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
90 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
91 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.5
Metatranscriptomes 2.8
Isolates 0.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.7
Nodule 0
Rhizoplane 2.1
Rhizosphere 67.83
Stem 0
Stem Tuber 0
Unclassified 29.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058861_11465041 3300004800 Bacteria 719
2 Ga0058862_11873287 3300004803 Bacteria 647
3 Ga0070660_100597753 3300005339 Bacteria 922
4 Ga0070661_100050160 3300005344 Bacteria 3054
5 Ga0070671_101213211 3300005355 Bacteria 664
6 Ga0070659_100048952 3300005366 Unclassified 3322
7 Ga0070714_100178869 3300005435 Bacteria 1929
8 Ga0070713_101033077 3300005436 Bacteria 793
9 Ga0070708_100299249 3300005445 Bacteria 1515
10 Ga0070681_10085636 3300005458 Bacteria 3104
11 Ga0070707_101084595 3300005468 Bacteria 767
12 Ga0070699_100444671 3300005518 Bacteria 1175
13 Ga0070684_100838406 3300005535 Bacteria 860
14 Ga0070697_100845749 3300005536 Bacteria 810
15 Ga0068853_100071627 3300005539 Bacteria 3019
16 Ga0070665_100062210 3300005548 Bacteria 3743
17 Ga0068855_100047312 3300005563 Bacteria 5082
18 Ga0070664_100743192 3300005564 Bacteria 915
19 Ga0068856_100005254 3300005614 Bacteria 12770
20 Ga0068856_100085098 3300005614 Bacteria 3141
21 Ga0068852_100312760 3300005616 Unclassified 1523
22 Ga0081455_10036271 3300005937 Bacteria 4392
23 Ga0081455_10251876 3300005937 Bacteria 1291
24 Ga0070717_10011090 3300006028 Bacteria 6831
25 Ga0070712_100507952 3300006175 Bacteria 1011
26 Ga0097621_100503387 3300006237 Unclassified 1097
27 Ga0075428_100308528 3300006844 Bacteria 1701
28 Ga0075431_100027314 3300006847 Bacteria 5855
29 Ga0075434_100040399 3300006871 Bacteria 4619
30 Ga0075434_101048535 3300006871 Bacteria 829
31 Ga0075436_100009186 3300006914 Bacteria 6765
32 Ga0105240_10025270 3300009093 Bacteria 7809
33 Ga0105237_10462928 3300009545 Bacteria 1274
34 Ga0105239_11794057 3300010375 Unclassified 711
35 Ga0157373_10237599 3300013100 Bacteria 1288
36 Ga0157370_10219595 3300013104 Unclassified 1761
37 Ga0157370_10222495 3300013104 Unclassified 1748
38 Ga0157369_10000661 3300013105 Bacteria 44651
39 Ga0157369_10122140 3300013105 Bacteria 2762
40 Ga0157369_10387556 3300013105 Bacteria 1450
41 Ga0157374_10012493 3300013296 Bacteria 7392
42 Ga0157372_10057139 3300013307 Bacteria 4362
43 Ga0157372_11487019 3300013307 Unclassified 780
44 Ga0157376_10227877 3300014969 Bacteria 1729
45 Ga0157376_10270755 3300014969 Unclassified 1595
46 Ga0213874_10098196 3300021377 Bacteria 970
47 Ga0213876_10006751 3300021384 Bacteria 6265
48 Ga0213876_10039690 3300021384 Unclassified 2487
49 Ga0213875_10000004 3300021388 Bacteria 703388
50 Ga0213875_10000566 3300021388 Bacteria 30156
51 Ga0213875_10001440 3300021388 Bacteria 15426
52 Ga0213875_10002956 3300021388 Bacteria 9903
53 Ga0213875_10031656 3300021388 Bacteria 2501
54 Ga0213875_10065175 3300021388 Bacteria 1702
55 Ga0213875_10069870 3300021388 Bacteria 1639
56 Ga0213875_10084581 3300021388 Bacteria 1480
57 Ga0213875_10345489 3300021388 Unclassified 706
58 Ga0213875_10354601 3300021388 Bacteria 697
59 Ga0209566_100122 3300025225 Bacteria 101406
60 Ga0207693_10067076 3300025915 Bacteria 2809
61 Ga0207657_10098278 3300025919 Unclassified 2433
62 Ga0207657_10203290 3300025919 Bacteria 1592
63 Ga0207649_10038546 3300025920 Bacteria 2894
64 Ga0207700_10892201 3300025928 Bacteria 796
65 Ga0207679_10652384 3300025945 Bacteria 952
66 Ga0207667_10016828 3300025949 Bacteria 8249
67 Ga0207639_10009366 3300026041 Bacteria 6752
68 Ga0207702_10007992 3300026078 Bacteria 8962
69 Ga0207702_10035893 3300026078 Bacteria 4146
70 Ga0207683_10132921 3300026121 Bacteria 2238
71 Ga0207683_11193175 3300026121 Unclassified 705
72 Ga0207698_10664106 3300026142 Bacteria 1034
73 Ga0268266_10101664 3300028379 Bacteria 2534
74 Ga0268265_11485394 3300028380 Bacteria 681
75 Ga0265765_1014303 3300030879 Unclassified 914
76 Ga0265760_10008437 3300031090 Unclassified 2947
77 Ga0265330_10135587 3300031235 Bacteria 1047
78 Ga0265325_10133038 3300031241 Bacteria 1189
79 Ga0265316_10001399 3300031344 Bacteria 25955
80 Ga0307408_100013212 3300031548 Bacteria 5481
81 Ga0307412_10163860 3300031911 Bacteria 1655
82 Ga0307411_10005436 3300032005 Bacteria 6257
83 Ga0307415_100405641 3300032126 Bacteria 1165
84 Ga0373943_0248136 3300035170 Bacteria 999
85 Ga0395900_0085914 3300037418 Bacteria 3233
86 Ga0395905_0172712 3300037471 Bacteria 2030
87 Ga0436364_0154432 3300037853 Bacteria 4740
88 Ga0436364_0156251 3300037853 Bacteria 2149
89 Ga0436364_0290533 3300037853 Bacteria 5607
90 Ga0436364_0297453 3300037853 Bacteria 2265
91 Ga0436364_0442403 3300037853 Bacteria 4855
92 Ga0436364_0477076 3300037853 Unclassified 1980
93 Ga0436364_0477525 3300037853 Bacteria 2534
94 Ga0436364_0586366 3300037853 Bacteria 11130
95 Ga0436364_0727047 3300037853 Bacteria 2180
96 Ga0436364_0741188 3300037853 Unclassified 712
97 Ga0436364_0748068 3300037853 Bacteria 528910
98 Ga0436364_0842718 3300037853 Archaea 4933
99 Ga0436364_0965956 3300037853 Unclassified 3486
100 Ga0436364_1094497 3300037853 Unclassified 1898
101 Ga0436364_1206778 3300037853 Bacteria 3138
102 Ga0436364_1309642 3300037853 Unclassified 2723
103 Ga0436364_1479346 3300037853 Bacteria 794
104 Ga0436364_1526279 3300037853 Bacteria 19115
105 Ga0436364_1528714 3300037853 Bacteria 88642
106 Ga0395901_0028292 3300038443 Bacteria 5765
107 Ga0436365_0104190 3300039437 Bacteria 958
108 Ga0436365_0151152 3300039437 Bacteria 1867
109 Ga0436365_0576387 3300039437 Unclassified 2467
110 Ga0436365_1031452 3300039437 Bacteria 6167
111 Ga0436365_1684507 3300039437 Bacteria 6738
112 Ga0436365_1763167 3300039437 Bacteria 50607
113 Ga0436360_1242788 3300039438 Unclassified 1022
114 Ga0436363_0014438 3300039450 Unclassified 584
115 Ga0436363_0763254 3300039450 Bacteria 2961
116 Ga0436363_1357067 3300039450 Unclassified 1600
117 Ga0436362_0233578 3300039453 Bacteria 603
118 Ga0436362_0934391 3300039453 Bacteria 3704
119 Ga0436362_0978431 3300039453 Bacteria 9345
120 Ga0466958_0042838 3300045836 Unclassified 2726
121 Ga0466967_1327866 3300045976 Bacteria 716
122 Ga0496102_0381294 3300048905 Bacteria 1327
123 Ga0496112_0102945 3300048915 Unclassified 2825
124 Ga0496115_0989440 3300048918 Bacteria 643
125 Ga0501039_0970151 3300049575 Bacteria 661
126 Ga0501042_0126323 3300049578 Bacteria 1842
127 Ga0501047_0115252 3300049581 Bacteria 2569
128 Ga0501047_0137208 3300049581 Unclassified 2326
129 Ga0501072_0199920 3300049588 Bacteria 1593
130 Ga0501074_0499551 3300049590 Bacteria 862
131 Ga0501075_0313307 3300049591 Bacteria 1196
132 Ga0501075_0598327 3300049591 Bacteria 841
133 Ga0501077_0620221 3300049593 Bacteria 695
134 Ga0501079_0268454 3300049741 Bacteria 1334
135 Ga0501081_0091029 3300049743 Bacteria 2145
136 Ga0501035_0053568 3300049822 Bacteria 3607
137 Ga0501044_0000814 3300049823 Bacteria 37495
138 Ga0501044_0007237 3300049823 Bacteria 12200
139 nmdc:mga06r32_73805_c1 3300050510 Bacteria 3306
140 nmdc:mga0n895_13086_c1 3300050512 Bacteria 6742
141 nmdc:mga0n895_519582_c1 3300050512 Bacteria 1198
142 nmdc:mga08x19_5758_c1 3300050514 Bacteria 7330

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_0290533 Ga0436364_0290533_113_586 153
2 3300006028 Ga0070717_10011090 Ga0070717_100110908 155
3 3300031241 Ga0265325_10133038 Ga0265325_101330382 157
4 3300050510 nmdc:mga06r32_73805_c1 nmdc:mga06r32_73805_c1_2252_2797 157
5 3300006844 Ga0075428_100308528 Ga0075428_1003085281 159
6 3300006847 Ga0075431_100027314 Ga0075431_1000273142 159
7 3300028380 Ga0268265_11485394 Ga0268265_114853941 159
8 3300045976 Ga0466967_1327866 Ga0466967_1327866_191_682 159
9 3300026121 Ga0207683_11193175 Ga0207683_111931751 160
10 3300039453 Ga0436362_0233578 Ga0436362_0233578_92_589 160
11 3300048918 Ga0496115_0989440 Ga0496115_0989440_105_599 160
12 3300006871 Ga0075434_100040399 Ga0075434_1000403994 165
13 3300021388 Ga0213875_10002956 Ga0213875_100029565 165
14 3300037853 Ga0436364_0442403 Ga0436364_0442403_2377_2877 165
15 3300037853 Ga0436364_0965956 Ga0436364_0965956_1890_2390 165
16 3300013105 Ga0157369_10387556 Ga0157369_103875562 166
17 3300049575 Ga0501039_0970151 Ga0501039_0970151_85_600 167
18 iso_pu_bacteria 2818991459 2819673751 168
19 3300025225 Ga0209566_100122 Ga0209566_10012285 169
20 3300049581 Ga0501047_0115252 Ga0501047_0115252_29_547 169
21 3300049581 Ga0501047_0137208 Ga0501047_0137208_457_975 169
22 3300049590 Ga0501074_0499551 Ga0501074_0499551_20_538 169
23 3300049822 Ga0501035_0053568 Ga0501035_0053568_1831_2349 169
24 3300049823 Ga0501044_0000814 Ga0501044_0000814_33121_33639 169
25 3300049823 Ga0501044_0007237 Ga0501044_0007237_2420_2938 169
26 3300006914 Ga0075436_100009186 Ga0075436_1000091867 170
27 3300009093 Ga0105240_10025270 Ga0105240_100252705 170
28 3300030879 Ga0265765_1014303 Ga0265765_10143031 170
29 3300031090 Ga0265760_10008437 Ga0265760_100084372 170
30 3300031548 Ga0307408_100013212 Ga0307408_1000132125 170
31 3300031911 Ga0307412_10163860 Ga0307412_101638601 170
32 3300032005 Ga0307411_10005436 Ga0307411_100054367 170
33 3300032126 Ga0307415_100405641 Ga0307415_1004056412 170
34 3300049578 Ga0501042_0126323 Ga0501042_0126323_972_1502 170
35 3300049588 Ga0501072_0199920 Ga0501072_0199920_652_1182 170
36 3300049591 Ga0501075_0313307 Ga0501075_0313307_271_801 170
37 3300049591 Ga0501075_0598327 Ga0501075_0598327_100_630 170
38 3300049593 Ga0501077_0620221 Ga0501077_0620221_10_540 170
39 3300049741 Ga0501079_0268454 Ga0501079_0268454_267_797 170
40 3300049743 Ga0501081_0091029 Ga0501081_0091029_1156_1686 170
41 3300050512 nmdc:mga0n895_13086_c1 nmdc:mga0n895_13086_c1_4225_4770 170
42 3300050514 nmdc:mga08x19_5758_c1 nmdc:mga08x19_5758_c1_5462_5992 170
43 3300005445 Ga0070708_100299249 Ga0070708_1002992492 171
44 3300005468 Ga0070707_101084595 Ga0070707_1010845951 171
45 3300005518 Ga0070699_100444671 Ga0070699_1004446711 171
46 3300005536 Ga0070697_100845749 Ga0070697_1008457491 171
47 3300005937 Ga0081455_10251876 Ga0081455_102518761 171
48 3300021388 Ga0213875_10000004 Ga0213875_10000004423 171
49 3300021388 Ga0213875_10031656 Ga0213875_100316562 171
50 3300037418 Ga0395900_0085914 Ga0395900_0085914_2100_2630 171
51 3300037471 Ga0395905_0172712 Ga0395905_0172712_1285_1815 171
52 3300037853 Ga0436364_0727047 Ga0436364_0727047_1509_2042 171
53 3300037853 Ga0436364_0748068 Ga0436364_0748068_139636_140172 171
54 3300038443 Ga0395901_0028292 Ga0395901_0028292_4578_5108 171
55 3300021377 Ga0213874_10098196 Ga0213874_100981962 172
56 3300021388 Ga0213875_10001440 Ga0213875_100014402 172
57 3300037853 Ga0436364_0154432 Ga0436364_0154432_4122_4664 172
58 3300037853 Ga0436364_0297453 Ga0436364_0297453_566_1108 172
59 3300037853 Ga0436364_0477076 Ga0436364_0477076_103_621 172
60 3300037853 Ga0436364_1094497 Ga0436364_1094497_631_1164 172
61 3300039437 Ga0436365_1031452 Ga0436365_1031452_1854_2411 172
62 3300039437 Ga0436365_1684507 Ga0436365_1684507_5019_5555 172
63 3300039450 Ga0436363_1357067 Ga0436363_1357067_543_1061 172
64 3300039453 Ga0436362_0978431 Ga0436362_0978431_2630_3148 172
65 3300004800 Ga0058861_11465041 Ga0058861_114650412 173
66 3300004803 Ga0058862_11873287 Ga0058862_118732871 173
67 3300005339 Ga0070660_100597753 Ga0070660_1005977531 173
68 3300005344 Ga0070661_100050160 Ga0070661_1000501602 173
69 3300005355 Ga0070671_101213211 Ga0070671_1012132111 173
70 3300005366 Ga0070659_100048952 Ga0070659_1000489522 173
71 3300005435 Ga0070714_100178869 Ga0070714_1001788693 173
72 3300005436 Ga0070713_101033077 Ga0070713_1010330771 173
73 3300005458 Ga0070681_10085636 Ga0070681_100856362 173
74 3300005535 Ga0070684_100838406 Ga0070684_1008384062 173
75 3300005539 Ga0068853_100071627 Ga0068853_1000716274 173
76 3300005548 Ga0070665_100062210 Ga0070665_1000622103 173
77 3300005563 Ga0068855_100047312 Ga0068855_1000473125 173
78 3300005564 Ga0070664_100743192 Ga0070664_1007431921 173
79 3300005614 Ga0068856_100005254 Ga0068856_1000052542 173
80 3300005614 Ga0068856_100085098 Ga0068856_1000850981 173
81 3300005616 Ga0068852_100312760 Ga0068852_1003127602 173
82 3300005937 Ga0081455_10036271 Ga0081455_100362715 173
83 3300006175 Ga0070712_100507952 Ga0070712_1005079522 173
84 3300006237 Ga0097621_100503387 Ga0097621_1005033872 173
85 3300006871 Ga0075434_101048535 Ga0075434_1010485351 173
86 3300009545 Ga0105237_10462928 Ga0105237_104629282 173
87 3300010375 Ga0105239_11794057 Ga0105239_117940571 173
88 3300013100 Ga0157373_10237599 Ga0157373_102375992 173
89 3300013104 Ga0157370_10219595 Ga0157370_102195954 173
90 3300013104 Ga0157370_10222495 Ga0157370_102224951 173
91 3300013105 Ga0157369_10000661 Ga0157369_1000066130 173
92 3300013105 Ga0157369_10122140 Ga0157369_101221402 173
93 3300013296 Ga0157374_10012493 Ga0157374_100124935 173
94 3300013307 Ga0157372_10057139 Ga0157372_100571394 173
95 3300013307 Ga0157372_11487019 Ga0157372_114870192 173
96 3300014969 Ga0157376_10227877 Ga0157376_102278773 173
97 3300014969 Ga0157376_10270755 Ga0157376_102707553 173
98 3300021384 Ga0213876_10006751 Ga0213876_100067513 173
99 3300021384 Ga0213876_10039690 Ga0213876_100396902 173
100 3300021388 Ga0213875_10000566 Ga0213875_100005666 173
101 3300021388 Ga0213875_10065175 Ga0213875_100651751 173
102 3300021388 Ga0213875_10069870 Ga0213875_100698702 173
103 3300021388 Ga0213875_10084581 Ga0213875_100845812 173
104 3300021388 Ga0213875_10345489 Ga0213875_103454891 173
105 3300021388 Ga0213875_10354601 Ga0213875_103546011 173
106 3300025915 Ga0207693_10067076 Ga0207693_100670764 173
107 3300025919 Ga0207657_10098278 Ga0207657_100982782 173
108 3300025919 Ga0207657_10203290 Ga0207657_102032902 173
109 3300025920 Ga0207649_10038546 Ga0207649_100385462 173
110 3300025928 Ga0207700_10892201 Ga0207700_108922011 173
111 3300025945 Ga0207679_10652384 Ga0207679_106523842 173
112 3300025949 Ga0207667_10016828 Ga0207667_100168283 173
113 3300026041 Ga0207639_10009366 Ga0207639_100093663 173
114 3300026078 Ga0207702_10007992 Ga0207702_100079922 173
115 3300026078 Ga0207702_10035893 Ga0207702_100358932 173
116 3300026121 Ga0207683_10132921 Ga0207683_101329213 173
117 3300026142 Ga0207698_10664106 Ga0207698_106641062 173
118 3300028379 Ga0268266_10101664 Ga0268266_101016642 173
119 3300031235 Ga0265330_10135587 Ga0265330_101355872 173
120 3300031344 Ga0265316_10001399 Ga0265316_100013997 173
121 3300035170 Ga0373943_0248136 Ga0373943_0248136_299_844 173
122 3300037853 Ga0436364_0156251 Ga0436364_0156251_561_1094 173
123 3300037853 Ga0436364_0477525 Ga0436364_0477525_804_1358 173
124 3300037853 Ga0436364_0586366 Ga0436364_0586366_5317_5853 173
125 3300037853 Ga0436364_0741188 Ga0436364_0741188_157_696 173
126 3300037853 Ga0436364_0842718 Ga0436364_0842718_2094_2645 173
127 3300037853 Ga0436364_1206778 Ga0436364_1206778_1668_2219 173
128 3300037853 Ga0436364_1309642 Ga0436364_1309642_1972_2520 173
129 3300037853 Ga0436364_1479346 Ga0436364_1479346_28_564 173
130 3300037853 Ga0436364_1526279 Ga0436364_1526279_18385_18933 173
131 3300037853 Ga0436364_1528714 Ga0436364_1528714_63096_63644 173
132 3300039437 Ga0436365_0104190 Ga0436365_0104190_32_571 173
133 3300039437 Ga0436365_0151152 Ga0436365_0151152_992_1525 173
134 3300039437 Ga0436365_0576387 Ga0436365_0576387_1280_1819 173
135 3300039437 Ga0436365_1763167 Ga0436365_1763167_40563_41105 173
136 3300039438 Ga0436360_1242788 Ga0436360_1242788_190_732 173
137 3300039450 Ga0436363_0014438 Ga0436363_0014438_32_574 173
138 3300039450 Ga0436363_0763254 Ga0436363_0763254_472_1014 173
139 3300039453 Ga0436362_0934391 Ga0436362_0934391_757_1296 173
140 3300045836 Ga0466958_0042838 Ga0466958_0042838_1242_1787 173
141 3300048905 Ga0496102_0381294 Ga0496102_0381294_464_1009 173
142 3300048915 Ga0496112_0102945 Ga0496112_0102945_478_1023 173
143 3300050512 nmdc:mga0n895_519582_c1 nmdc:mga0n895_519582_c1_640_1167 173

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

25

152

0.97

PF08534

Redoxin

Redoxin

24

168

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jsz-assembly1.cif.gz_A solution structure of tpx in the reduced state 0.9552 5 167
1psq-assembly1.cif.gz_B structure of a probable thiol peroxidase from streptococcus pneumoniae 0.9412 7 167
3p7x-assembly1.cif.gz_A crystal structure of an atypical two-cysteine peroxiredoxin (saouhsc_01822) from staphylococcus aureus nctc8325 0.9388 6 167
2jsz-assembly1.cif.gz_A solution structure of tpx in the reduced state 0.9276 5 167
1psq-assembly1.cif.gz_B structure of a probable thiol peroxidase from streptococcus pneumoniae 0.9247 7 167
ID Description Score Start End Superfamily
1psqB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9399 7 167 3.40.30.10
1psqB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9287 7 167 3.40.30.10
4af2A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9205 1 163 3.40.30.10
2yzhD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9126 5 167 3.40.30.10
2cx4E00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8768 19 171 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A0S4PNV1-F1-model_v4 deleted 0.9736 1 168
AF-A0A2M8Q3L5-F1-model_v4 Thiol peroxidase 0.9728 1 171 GO:0008379
AF-A0A7C3DZD4-F1-model_v4 Thiol peroxidase (EC 1.11.1.-) 0.9721 32 169 GO:0008379
AF-A0A7V2XGX8-F1-model_v4 Thiol peroxidase (Tpx) (EC 1.11.1.24) (Peroxiredoxin tpx) (Prx) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin) 0.972 1 169 GO:0008379
AF-A0A348ZXC7-F1-model_v4 Thiol peroxidase (Tpx) (EC 1.11.1.24) (Peroxiredoxin tpx) (Prx) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin) 0.9705 1 168 GO:0008379

Feature Viewer

pLDDT pTM Quality
91.3 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map