F187114

General Info

Members Datasets Scaffolds Average Seq Length
142 113 142 213

Family's Representative Sequence

Representative Sequence 3300053078|Ga0495612_0033599|Ga0495612_0033599_768_1565
Length 250
Sequence VSTTRRPPIAANRRGHGAGKRGIVAATGGIAAAIAERVAVTIDELTVADAPEAWRDCGFEVVGDTCVVGDIRLRLAGPDTGRGLTGWTLRNKSNKSDDLDGLPTGRSERRPGHPNGIAAIDHVVAIAPDLDRTVATLEGAGLDLRRIREEPTPAGAPRQAFFRLGGAILEVVQEPEAATARRGGGDHSAFFWGLAFVAPDLERTAASLGDRAGEIRDAVQPGRRIATLRRSAGLAVPVALMTPAPGGEHG

Samples

Sample ID Description Type Environment
1 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
61 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
62 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
63 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
64 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
67 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
68 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
71 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
72 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
73 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
80 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
81 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
82 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
83 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
84 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
85 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
86 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
87 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
88 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
89 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
90 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
91 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
92 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
93 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
94 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
95 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
96 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
97 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
100 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
101 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
107 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
108 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
109 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
110 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
111 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
112 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
113 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.93
Nodule 0
Rhizoplane 11.97
Rhizosphere 82.39
Stem 0
Stem Tuber 0
Unclassified 0.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10000097 3300002239 Bacteria 15286
2 JGI25404J52841_10008004 3300003659 Bacteria 2243
3 Ga0070683_100022916 3300005329 Bacteria 5582
4 Ga0070680_100092083 3300005336 Bacteria 2510
5 Ga0070682_100037334 3300005337 Bacteria 2973
6 Ga0070682_100561396 3300005337 Bacteria 895
7 Ga0070689_100176602 3300005340 Unclassified 1733
8 Ga0070691_10000112 3300005341 Bacteria 24438
9 Ga0070692_10004735 3300005345 Bacteria 5709
10 Ga0070668_100093925 3300005347 Bacteria 2367
11 Ga0070675_100000070 3300005354 Bacteria 59599
12 Ga0070674_100092733 3300005356 Unclassified 2184
13 Ga0070659_100142218 3300005366 Unclassified 1954
14 Ga0070667_100001183 3300005367 Bacteria 23762
15 Ga0070701_10211782 3300005438 Unclassified 1151
16 Ga0070700_100316254 3300005441 Bacteria 1145
17 Ga0070708_100853594 3300005445 Bacteria 855
18 Ga0070663_100052177 3300005455 Unclassified 2916
19 Ga0070678_100420338 3300005456 Bacteria 1165
20 Ga0070684_100082386 3300005535 Bacteria 2849
21 Ga0070686_100160387 3300005544 Bacteria 1583
22 Ga0070665_100000308 3300005548 Bacteria 76310
23 Ga0070665_100322935 3300005548 Bacteria 1548
24 Ga0070664_100090078 3300005564 Bacteria 2654
25 Ga0068854_100101294 3300005578 Unclassified 2160
26 Ga0070702_100617331 3300005615 Unclassified 815
27 Ga0068851_10059445 3300005834 Unclassified 1955
28 Ga0068858_100000066 3300005842 Bacteria 108011
29 Ga0068858_100054636 3300005842 Bacteria 3693
30 Ga0068862_100005896 3300005844 Bacteria 10205
31 Ga0081455_10018012 3300005937 Bacteria 6745
32 Ga0081540_1000116 3300005983 Bacteria 84152
33 Ga0075365_10162893 3300006038 Unclassified 1555
34 Ga0075365_10260333 3300006038 Unclassified 1220
35 Ga0075363_100011954 3300006048 Bacteria 4171
36 Ga0075364_10126912 3300006051 Unclassified 1711
37 Ga0105247_10000275 3300009101 Bacteria 47915
38 Ga0105237_10000540 3300009545 Bacteria 53364
39 Ga0105249_10001967 3300009553 Bacteria 17832
40 Ga0105249_11661307 3300009553 Unclassified 711
41 Ga0105246_10025426 3300011119 Bacteria 3859
42 Ga0157371_10257563 3300013102 Unclassified 1257
43 Ga0157378_10026903 3300013297 Bacteria 5073
44 Ga0157372_10136044 3300013307 Bacteria 2830
45 Ga0157375_10001556 3300013308 Bacteria 19758
46 Ga0157375_10122715 3300013308 Bacteria 2710
47 Ga0157375_10343894 3300013308 Unclassified 1657
48 Ga0163161_10000027 3300017792 Bacteria 197774
49 Ga0207710_10000477 3300025900 Bacteria 25496
50 Ga0207688_10046985 3300025901 Unclassified 2410
51 Ga0207671_10001084 3300025914 Bacteria 32949
52 Ga0207660_10291397 3300025917 Bacteria 1298
53 Ga0207662_10391405 3300025918 Unclassified 941
54 Ga0207694_10000012 3300025924 Bacteria 411218
55 Ga0207659_10000018 3300025926 Bacteria 156920
56 Ga0207659_10191128 3300025926 Unclassified 1629
57 Ga0207687_10096550 3300025927 Unclassified 2166
58 Ga0207669_10773727 3300025937 Unclassified 794
59 Ga0207679_10073944 3300025945 Bacteria 2580
60 Ga0207668_10020527 3300025972 Bacteria 4199
61 Ga0207658_10448733 3300025986 Unclassified 1141
62 Ga0207677_10137484 3300026023 Unclassified 1865
63 Ga0207703_10000042 3300026035 Bacteria 161459
64 Ga0207703_10000054 3300026035 Bacteria 143734
65 Ga0207703_10102935 3300026035 Bacteria 2423
66 Ga0207703_10384496 3300026035 Bacteria 1299
67 Ga0207678_10036039 3300026067 Bacteria 4307
68 Ga0268266_10000099 3300028379 Bacteria 182294
69 Ga0268266_10199138 3300028379 Bacteria 1832
70 Ga0268266_11133166 3300028379 Unclassified 757
71 Ga0268265_10004309 3300028380 Bacteria 9920
72 Ga0268264_10046660 3300028381 Bacteria 3599
73 Ga0268264_10289006 3300028381 Bacteria 1539
74 Ga0265337_1000123 3300028556 Bacteria 39654
75 Ga0265326_10000111 3300028558 Bacteria 41592
76 Ga0265319_1000035 3300028563 Bacteria 117269
77 Ga0265322_10000005 3300028654 Bacteria 246112
78 Ga0265336_10002176 3300028666 Bacteria 8281
79 Ga0265338_10000171 3300028800 Bacteria 120054
80 Ga0265324_10001504 3300029957 Bacteria 13183
81 Ga0265328_10003620 3300031239 Bacteria 6814
82 Ga0265320_10000293 3300031240 Bacteria 40653
83 Ga0265325_10026028 3300031241 Bacteria 3173
84 Ga0265329_10002397 3300031242 Bacteria 8500
85 Ga0265331_10001253 3300031250 Bacteria 19035
86 Ga0265331_10061971 3300031250 Bacteria 1765
87 Ga0265327_10000040 3300031251 Bacteria 291052
88 Ga0265313_10135834 3300031595 Bacteria 1061
89 Ga0265314_10000983 3300031711 Bacteria 33551
90 Ga0307406_10340417 3300031901 Bacteria 1168
91 Ga0307416_101021434 3300032002 Bacteria 930
92 Ga0466963_0044188 3300044694 Bacteria 2932
93 Ga0466959_0181434 3300045049 Bacteria 1472
94 Ga0495592_0121794 3300046454 Bacteria 1834
95 Ga0495603_0001292 3300046455 Bacteria 14588
96 Ga0495603_0001815 3300046455 Bacteria 12603
97 Ga0495591_036081 3300046458 Bacteria 1442
98 Ga0495629_0225898 3300046459 Bacteria 1291
99 Ga0495608_0000115 3300046511 Bacteria 56782
100 Ga0495608_0225199 3300046511 Bacteria 1175
101 Ga0495618_0078098 3300046514 Bacteria 2110
102 Ga0495630_0000167 3300046517 Bacteria 51244
103 Ga0495630_0427301 3300046517 Bacteria 1015
104 Ga0495644_0000372 3300046523 Bacteria 20354
105 Ga0495667_0000038 3300046559 Bacteria 131349
106 Ga0495667_0020006 3300046559 Bacteria 4514
107 Ga0495634_0000002 3300046642 Bacteria 247842
108 Ga0495635_0000005 3300046663 Bacteria 302178
109 Ga0495657_0038541 3300046675 Bacteria 3288
110 Ga0495599_0194064 3300046678 Bacteria 1248
111 Ga0495676_0000480 3300047321 Bacteria 32772
112 Ga0495684_0006748 3300047471 Bacteria 8912
113 Ga0495614_0014056 3300048089 Bacteria 3511
114 Ga0496100_0000035 3300048903 Bacteria 97592
115 Ga0496101_0000087 3300048904 Bacteria 101601
116 Ga0496102_0090744 3300048905 Bacteria 2828
117 Ga0496104_0005525 3300048907 Bacteria 11072
118 Ga0496105_0000095 3300048908 Bacteria 60866
119 Ga0496106_0000068 3300048909 Bacteria 83053
120 Ga0496106_0418204 3300048909 Bacteria 1077
121 Ga0496106_0624477 3300048909 Unclassified 862
122 Ga0496107_0000018 3300048910 Bacteria 158433
123 Ga0496107_0394317 3300048910 Unclassified 1030
124 Ga0496110_0117316 3300048913 Unclassified 2397
125 Ga0496110_1359050 3300048913 Bacteria 620
126 Ga0496112_0000013 3300048915 Bacteria 237194
127 Ga0496114_0000003 3300048917 Bacteria 630981
128 Ga0496114_0379904 3300048917 Bacteria 1251
129 Ga0496115_0000031 3300048918 Bacteria 138258
130 Ga0496115_0004851 3300048918 Bacteria 9759
131 Ga0496124_0172509 3300048927 Bacteria 1673
132 nmdc:mga00v17_148903_c1 3300050491 Unclassified 1503
133 nmdc:mga0yw44_53347_c1 3300050492 Bacteria 2455
134 nmdc:mga0yw44_597833_c1 3300050492 Unclassified 749
135 Ga0495601_0003583 3300053077 Bacteria 8930
136 Ga0495601_0003964 3300053077 Bacteria 8525
137 Ga0495612_0033599 3300053078 Bacteria 2076
138 Ga0495655_0000595 3300053083 Bacteria 5919
139 Ga0495595_0000113 3300053084 Bacteria 36421
140 Ga0495619_0000127 3300053085 Bacteria 55995
141 Ga0495619_0000538 3300053085 Bacteria 25059
142 Ga0495619_0107976 3300053085 Bacteria 1899

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026035 Ga0207703_10384496 Ga0207703_103844962 168
2 3300048913 Ga0496110_1359050 Ga0496110_1359050_84_602 168
3 3300031901 Ga0307406_10340417 Ga0307406_103404172 175
4 3300032002 Ga0307416_101021434 Ga0307416_1010214342 176
5 3300053084 Ga0495595_0000113 Ga0495595_0000113_32426_33061 196
6 3300005354 Ga0070675_100000070 Ga0070675_1000000704 198
7 3300025926 Ga0207659_10000018 Ga0207659_1000001860 198
8 3300003659 JGI25404J52841_10008004 JGI25404J52841_100080042 199
9 3300005983 Ga0081540_1000116 Ga0081540_100011621 199
10 3300028563 Ga0265319_1000035 Ga0265319_1000035102 199
11 3300028800 Ga0265338_10000171 Ga0265338_10000171105 199
12 3300031241 Ga0265325_10026028 Ga0265325_100260285 199
13 3300031250 Ga0265331_10061971 Ga0265331_100619714 199
14 3300031595 Ga0265313_10135834 Ga0265313_101358342 199
15 3300046517 Ga0495630_0000167 Ga0495630_0000167_36894_37556 202
16 3300046675 Ga0495657_0038541 Ga0495657_0038541_989_1651 202
17 3300005329 Ga0070683_100022916 Ga0070683_1000229162 204
18 3300005336 Ga0070680_100092083 Ga0070680_1000920832 204
19 3300005337 Ga0070682_100037334 Ga0070682_1000373342 204
20 3300005340 Ga0070689_100176602 Ga0070689_1001766022 204
21 3300005345 Ga0070692_10004735 Ga0070692_100047352 204
22 3300005356 Ga0070674_100092733 Ga0070674_1000927332 204
23 3300005366 Ga0070659_100142218 Ga0070659_1001422182 204
24 3300005438 Ga0070701_10211782 Ga0070701_102117821 204
25 3300005455 Ga0070663_100052177 Ga0070663_1000521773 204
26 3300005456 Ga0070678_100420338 Ga0070678_1004203382 204
27 3300005535 Ga0070684_100082386 Ga0070684_1000823864 204
28 3300005544 Ga0070686_100160387 Ga0070686_1001603872 204
29 3300005564 Ga0070664_100090078 Ga0070664_1000900783 204
30 3300005578 Ga0068854_100101294 Ga0068854_1001012942 204
31 3300005615 Ga0070702_100617331 Ga0070702_1006173311 204
32 3300005834 Ga0068851_10059445 Ga0068851_100594452 204
33 3300005842 Ga0068858_100054636 Ga0068858_1000546362 204
34 3300006038 Ga0075365_10162893 Ga0075365_101628931 204
35 3300006048 Ga0075363_100011954 Ga0075363_1000119544 204
36 3300006051 Ga0075364_10126912 Ga0075364_101269122 204
37 3300009553 Ga0105249_11661307 Ga0105249_116613071 204
38 3300011119 Ga0105246_10025426 Ga0105246_100254263 204
39 3300013102 Ga0157371_10257563 Ga0157371_102575631 204
40 3300013307 Ga0157372_10136044 Ga0157372_101360444 204
41 3300013308 Ga0157375_10343894 Ga0157375_103438942 204
42 3300025901 Ga0207688_10046985 Ga0207688_100469852 204
43 3300025917 Ga0207660_10291397 Ga0207660_102913972 204
44 3300025918 Ga0207662_10391405 Ga0207662_103914052 204
45 3300025926 Ga0207659_10191128 Ga0207659_101911282 204
46 3300025927 Ga0207687_10096550 Ga0207687_100965502 204
47 3300025937 Ga0207669_10773727 Ga0207669_107737271 204
48 3300025945 Ga0207679_10073944 Ga0207679_100739443 204
49 3300026023 Ga0207677_10137484 Ga0207677_101374842 204
50 3300026035 Ga0207703_10102935 Ga0207703_101029352 204
51 3300026067 Ga0207678_10036039 Ga0207678_100360392 204
52 3300048909 Ga0496106_0624477 Ga0496106_0624477_55_696 204
53 3300048910 Ga0496107_0394317 Ga0496107_0394317_191_832 204
54 3300048913 Ga0496110_0117316 Ga0496110_0117316_911_1552 204
55 3300050491 nmdc:mga00v17_148903_c1 nmdc:mga00v17_148903_c1_278_919 204
56 3300050492 nmdc:mga0yw44_53347_c1 nmdc:mga0yw44_53347_c1_65_706 204
57 3300005347 Ga0070668_100093925 Ga0070668_1000939252 205
58 3300005367 Ga0070667_100001183 Ga0070667_10000118319 205
59 3300005548 Ga0070665_100322935 Ga0070665_1003229352 205
60 3300005844 Ga0068862_100005896 Ga0068862_1000058969 205
61 3300005937 Ga0081455_10018012 Ga0081455_100180124 205
62 3300009553 Ga0105249_10001967 Ga0105249_1000196711 205
63 3300025972 Ga0207668_10020527 Ga0207668_100205276 205
64 3300025986 Ga0207658_10448733 Ga0207658_104487332 205
65 3300028379 Ga0268266_10199138 Ga0268266_101991382 205
66 3300028380 Ga0268265_10004309 Ga0268265_100043099 205
67 3300028381 Ga0268264_10046660 Ga0268264_100466603 205
68 3300028381 Ga0268264_10289006 Ga0268264_102890062 205
69 3300046511 Ga0495608_0000115 Ga0495608_0000115_15979_16608 205
70 3300046678 Ga0495599_0194064 Ga0495599_0194064_387_1010 205
71 3300048909 Ga0496106_0418204 Ga0496106_0418204_87_725 205
72 3300005337 Ga0070682_100561396 Ga0070682_1005613962 206
73 3300005341 Ga0070691_10000112 Ga0070691_100001125 206
74 3300046459 Ga0495629_0225898 Ga0495629_0225898_220_885 206
75 3300046559 Ga0495667_0000038 Ga0495667_0000038_102512_103141 206
76 3300053083 Ga0495655_0000595 Ga0495655_0000595_674_1312 206
77 3300053085 Ga0495619_0000538 Ga0495619_0000538_7003_7674 206
78 3300005441 Ga0070700_100316254 Ga0070700_1003162542 207
79 3300005548 Ga0070665_100000308 Ga0070665_10000030813 207
80 3300005842 Ga0068858_100000066 Ga0068858_10000006673 207
81 3300006038 Ga0075365_10260333 Ga0075365_102603331 207
82 3300013308 Ga0157375_10001556 Ga0157375_100015562 207
83 3300013308 Ga0157375_10122715 Ga0157375_101227152 207
84 3300017792 Ga0163161_10000027 Ga0163161_1000002773 207
85 3300026035 Ga0207703_10000042 Ga0207703_10000042119 207
86 3300026035 Ga0207703_10000054 Ga0207703_1000005472 207
87 3300028379 Ga0268266_10000099 Ga0268266_1000009973 207
88 3300028556 Ga0265337_1000123 Ga0265337_100012328 207
89 3300028558 Ga0265326_10000111 Ga0265326_1000011128 207
90 3300028654 Ga0265322_10000005 Ga0265322_10000005249 207
91 3300028666 Ga0265336_10002176 Ga0265336_100021766 207
92 3300029957 Ga0265324_10001504 Ga0265324_1000150417 207
93 3300031239 Ga0265328_10003620 Ga0265328_100036206 207
94 3300031240 Ga0265320_10000293 Ga0265320_1000029327 207
95 3300031242 Ga0265329_10002397 Ga0265329_100023977 207
96 3300031250 Ga0265331_10001253 Ga0265331_100012538 207
97 3300031251 Ga0265327_10000040 Ga0265327_1000004011 207
98 3300031711 Ga0265314_10000983 Ga0265314_1000098311 207
99 3300045049 Ga0466959_0181434 Ga0466959_0181434_57_707 207
100 3300046454 Ga0495592_0121794 Ga0495592_0121794_511_1140 207
101 3300046458 Ga0495591_036081 Ga0495591_036081_68_712 207
102 3300046511 Ga0495608_0225199 Ga0495608_0225199_218_850 207
103 3300046514 Ga0495618_0078098 Ga0495618_0078098_414_1055 207
104 3300046559 Ga0495667_0020006 Ga0495667_0020006_1155_1811 207
105 3300046642 Ga0495634_0000002 Ga0495634_0000002_181524_182180 207
106 3300048089 Ga0495614_0014056 Ga0495614_0014056_2437_3084 207
107 3300048907 Ga0496104_0005525 Ga0496104_0005525_10022_10657 207
108 3300048908 Ga0496105_0000095 Ga0496105_0000095_37535_38170 207
109 3300048917 Ga0496114_0000003 Ga0496114_0000003_551391_552026 207
110 3300048917 Ga0496114_0379904 Ga0496114_0379904_398_1030 207
111 3300048918 Ga0496115_0000031 Ga0496115_0000031_99477_100112 207
112 3300048918 Ga0496115_0004851 Ga0496115_0004851_9092_9724 207
113 3300048927 Ga0496124_0172509 Ga0496124_0172509_878_1531 207
114 3300050492 nmdc:mga0yw44_597833_c1 nmdc:mga0yw44_597833_c1_38_670 207
115 3300053077 Ga0495601_0003583 Ga0495601_0003583_5766_6404 207
116 3300053077 Ga0495601_0003964 Ga0495601_0003964_7353_7988 207
117 3300009101 Ga0105247_10000275 Ga0105247_100002754 208
118 3300013297 Ga0157378_10026903 Ga0157378_100269036 208
119 3300025900 Ga0207710_10000477 Ga0207710_100004773 208
120 3300025924 Ga0207694_10000012 Ga0207694_1000001265 208
121 3300048915 Ga0496112_0000013 Ga0496112_0000013_87620_88258 208
122 3300028379 Ga0268266_11133166 Ga0268266_111331661 209
123 3300046455 Ga0495603_0001292 Ga0495603_0001292_6115_6759 209
124 3300046455 Ga0495603_0001815 Ga0495603_0001815_11163_11834 209
125 3300047321 Ga0495676_0000480 Ga0495676_0000480_26724_27395 209
126 3300048903 Ga0496100_0000035 Ga0496100_0000035_30895_31566 209
127 3300048904 Ga0496101_0000087 Ga0496101_0000087_34939_35610 209
128 3300048909 Ga0496106_0000068 Ga0496106_0000068_47882_48553 209
129 3300048910 Ga0496107_0000018 Ga0496107_0000018_141491_142162 209
130 3300053078 Ga0495612_0033599 Ga0495612_0033599_768_1565 209
131 3300053085 Ga0495619_0107976 Ga0495619_0107976_60_857 209
132 3300046523 Ga0495644_0000372 Ga0495644_0000372_12904_13539 210
133 3300046663 Ga0495635_0000005 Ga0495635_0000005_91159_91830 210
134 3300053085 Ga0495619_0000127 Ga0495619_0000127_44010_44702 211
135 3300047471 Ga0495684_0006748 Ga0495684_0006748_2232_2996 212
136 3300048905 Ga0496102_0090744 Ga0496102_0090744_1890_2648 212
137 3300005445 Ga0070708_100853594 Ga0070708_1008535941 213
138 3300046517 Ga0495630_0427301 Ga0495630_0427301_84_848 213
139 3300009545 Ga0105237_10000540 Ga0105237_1000054012 214
140 3300025914 Ga0207671_10001084 Ga0207671_1000108412 214
141 3300044694 Ga0466963_0044188 Ga0466963_0044188_171_845 214
142 3300002239 JGI24034J26672_10000097 JGI24034J26672_1000009716 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

119

235

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rmu-assembly2.cif.gz_D crystal structure of human methylmalonyl-coa epimerase, mcee 0.7895 88 215
6qh4-assembly2.cif.gz_B crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant 0.7838 89 215
6qh4-assembly1.cif.gz_A crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant 0.7828 89 215
6qh4-assembly2.cif.gz_D-2 crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant 0.7827 89 215
6wf7-assembly1.cif.gz_A methylmalonyl-coa epimerase in complex with methylmalonyl-coa and nh4+ 0.7808 89 214
ID Description Score Start End Superfamily
af_F1M8A9_28_144_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.8165 130 145 3.40.50.1470
af_L7N6B1_8_152_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7855 88 215 3.10.180.10
6qh4A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7828 89 215 3.10.180.10
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7566 92 215 3.10.180.10
6qh4A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7558 89 215 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A838UYL7-F1-model_v4 Glyoxalase 0.9879 8 215
AF-A0A524J8I7-F1-model_v4 Uncharacterized protein 0.9789 169 215
AF-A0A838UYL7-F1-model_v4 Glyoxalase 0.974 8 215
AF-A0A840IMB1-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9501 9 215 GO:0016829
GO:0051213
AF-A0A7V9NTY5-F1-model_v4 Glyoxalase 0.9359 9 215

Feature Viewer

pLDDT pTM Quality
92.46 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map