F186053

General Info

Members Datasets Scaffolds Average Seq Length
142 79 142 228

Family's Representative Sequence

Representative Sequence 3300028653|Ga0265323_10036192|Ga0265323_100361922
Length 247
Sequence MVSSQTRSPVNNPMSLRKPFAASPLLVRVAPFVIFLALTFCQGQFGEASRYWFYLAKTLVGAWLIWEMRPFVSEMRWAMSWEAVVVGVAVFAAWVGISGEWTTQNSLWVKLGISHAAPKAAPLWNPNDQFDSGSALAWLFIATRILGSTFIVPPLEEVFYRSFLYRYIAKPDFQSVPLNQFLPLPFLATAAVFGFSHNEWLAGILCGAAYQWLVIRKNRLGDAMTAHAITNFLLGLWVVWRGAWHFW

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
3 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
4 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
5 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
6 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
9 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
10 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
11 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
12 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
13 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
14 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
15 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
16 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
17 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
20 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
23 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
26 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
27 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
28 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
29 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
39 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
40 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
41 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
42 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
43 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
44 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
45 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
46 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
47 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
48 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
49 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
50 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
51 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
52 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
53 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
54 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
55 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
56 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
57 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
58 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
59 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
60 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
61 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
62 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
63 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
64 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
65 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
66 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
67 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
68 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
69 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
70 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
71 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
72 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
73 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
74 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
75 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
76 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
77 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
78 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
79 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.41
Rhizosphere 98.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100020536 3300005340 Bacteria 4902
2 Ga0070705_100239420 3300005440 Unclassified 1267
3 Ga0070681_10092829 3300005458 Bacteria 2967
4 Ga0070681_10598411 3300005458 Bacteria 1017
5 Ga0070684_100275011 3300005535 Bacteria 1542
6 Ga0070684_100478566 3300005535 Unclassified 1152
7 Ga0068853_100352567 3300005539 Bacteria 1369
8 Ga0068855_100003834 3300005563 Bacteria 18385
9 Ga0068855_100346671 3300005563 Bacteria 1637
10 Ga0068856_100000573 3300005614 Bacteria 40247
11 Ga0068856_100046544 3300005614 Bacteria 4273
12 Ga0070702_100214500 3300005615 Unclassified 1283
13 Ga0068859_100408931 3300005617 Unclassified 1453
14 Ga0068859_100735248 3300005617 Unclassified 1076
15 Ga0068864_100086731 3300005618 Bacteria 2754
16 Ga0068863_100204085 3300005841 Bacteria 1902
17 Ga0068863_100292232 3300005841 Unclassified 1580
18 Ga0070712_100045227 3300006175 Unclassified 3039
19 Ga0070712_100144360 3300006175 Unclassified 1820
20 Ga0075430_100035633 3300006846 Bacteria 4222
21 Ga0075433_10241543 3300006852 Unclassified 1603
22 Ga0075434_100266215 3300006871 Bacteria 1733
23 Ga0075436_100266940 3300006914 Bacteria 1221
24 Ga0097620_100408938 3300006931 Unclassified 1453
25 Ga0097620_100735103 3300006931 Unclassified 1076
26 Ga0105240_10270663 3300009093 Bacteria 1956
27 Ga0105241_10476046 3300009174 Bacteria 1109
28 Ga0105248_10576746 3300009177 Bacteria 1269
29 Ga0105238_10066737 3300009551 Bacteria 3598
30 Ga0105238_10159836 3300009551 Unclassified 2229
31 Ga0105238_10618989 3300009551 Unclassified 1091
32 Ga0157371_10346980 3300013102 Bacteria 1080
33 Ga0157378_10071488 3300013297 Bacteria 3116
34 Ga0157378_10397322 3300013297 Bacteria 1357
35 Ga0157372_10646873 3300013307 Bacteria 1231
36 Ga0157375_10026043 3300013308 Bacteria 5445
37 Ga0163163_10106343 3300014325 Bacteria 2832
38 Ga0157379_10789030 3300014968 Bacteria 896
39 Ga0157376_10986184 3300014969 Unclassified 864
40 Ga0207693_10283308 3300025915 Bacteria 1299
41 Ga0207694_10469251 3300025924 Unclassified 1052
42 Ga0207670_10007303 3300025936 Bacteria 6153
43 Ga0207667_10016208 3300025949 Bacteria 8423
44 Ga0207667_10106627 3300025949 Unclassified 2890
45 Ga0207703_10767760 3300026035 Unclassified 919
46 Ga0207639_10186480 3300026041 Bacteria 1769
47 Ga0207702_10000808 3300026078 Bacteria 33196
48 Ga0207641_10442531 3300026088 Bacteria 1255
49 Ga0207676_10054571 3300026095 Bacteria 3133
50 Ga0265337_1001832 3300028556 Bacteria 10187
51 Ga0265337_1011846 3300028556 Bacteria 2989
52 Ga0265337_1013152 3300028556 Bacteria 2789
53 Ga0265337_1013515 3300028556 Unclassified 2735
54 Ga0265337_1026381 3300028556 Bacteria 1760
55 Ga0265337_1036483 3300028556 Unclassified 1434
56 Ga0265326_10026026 3300028558 Bacteria 1669
57 Ga0265326_10032329 3300028558 Bacteria 1490
58 Ga0265319_1000003 3300028563 Bacteria 340561
59 Ga0265319_1010011 3300028563 Bacteria 3983
60 Ga0265319_1083908 3300028563 Unclassified 1010
61 Ga0265323_10000183 3300028653 Bacteria 37704
62 Ga0265323_10010515 3300028653 Bacteria 3749
63 Ga0265323_10036192 3300028653 Bacteria 1816
64 Ga0265323_10050845 3300028653 Bacteria 1472
65 Ga0265323_10053363 3300028653 Unclassified 1427
66 Ga0265322_10007153 3300028654 Bacteria 3267
67 Ga0265338_10000184 3300028800 Bacteria 116834
68 Ga0265338_10000494 3300028800 Bacteria 70344
69 Ga0265338_10000701 3300028800 Bacteria 57480
70 Ga0265338_10001733 3300028800 Bacteria 34498
71 Ga0265338_10001968 3300028800 Bacteria 31992
72 Ga0265338_10002298 3300028800 Bacteria 29060
73 Ga0265338_10006014 3300028800 Bacteria 15591
74 Ga0265338_10028082 3300028800 Bacteria 5623
75 Ga0265338_10028256 3300028800 Bacteria 5599
76 Ga0265338_10037676 3300028800 Bacteria 4596
77 Ga0265338_10043402 3300028800 Bacteria 4171
78 Ga0265338_10077364 3300028800 Unclassified 2813
79 Ga0265338_10078715 3300028800 Unclassified 2778
80 Ga0265338_10087314 3300028800 Bacteria 2592
81 Ga0265338_10088615 3300028800 Bacteria 2567
82 Ga0265338_10105797 3300028800 Bacteria 2280
83 Ga0265338_10128234 3300028800 Unclassified 2009
84 Ga0265338_10145034 3300028800 Bacteria 1853
85 Ga0265338_10193386 3300028800 Unclassified 1540
86 Ga0265338_10242861 3300028800 Bacteria 1333
87 Ga0265324_10000058 3300029957 Bacteria 93345
88 Ga0265324_10017085 3300029957 Bacteria 2639
89 Ga0265320_10000296 3300031240 Bacteria 40524
90 Ga0265320_10000488 3300031240 Bacteria 31056
91 Ga0265320_10006148 3300031240 Bacteria 7601
92 Ga0265320_10036694 3300031240 Bacteria 2475
93 Ga0265320_10053329 3300031240 Unclassified 1955
94 Ga0265325_10011888 3300031241 Bacteria 4991
95 Ga0265340_10000162 3300031247 Bacteria 33635
96 Ga0265340_10040301 3300031247 Bacteria 2301
97 Ga0265340_10044638 3300031247 Unclassified 2168
98 Ga0265327_10009551 3300031251 Bacteria 6979
99 Ga0265327_10137673 3300031251 Unclassified 1143
100 Ga0265316_10004185 3300031344 Bacteria 14419
101 Ga0265316_10010832 3300031344 Bacteria 8284
102 Ga0265316_10065572 3300031344 Unclassified 2812
103 Ga0265316_10069412 3300031344 Bacteria 2719
104 Ga0265316_10069468 3300031344 Bacteria 2718
105 Ga0265313_10005395 3300031595 Bacteria 9430
106 Ga0316575_10159752 3300031665 Unclassified 932
107 Ga0265314_10039861 3300031711 Bacteria 3378
108 Ga0265314_10053868 3300031711 Bacteria 2787
109 Ga0265342_10102209 3300031712 Unclassified 1631
110 Ga0373934_0086876 3300035086 Unclassified 1259
111 Ga0373954_0022683 3300035118 Bacteria 2850
112 Ga0373927_0001027 3300035695 Bacteria 21256
113 Ga0373937_0049034 3300036401 Bacteria 3867
114 Ga0451577_0029324 3300042876 Bacteria 4973
115 Ga0453684_0001011 3300044712 Bacteria 90768
116 Ga0453684_0008573 3300044712 Bacteria 18245
117 Ga0453684_1883178 3300044712 Unclassified 606
118 Ga0451576_0104817 3300045051 Bacteria 2942
119 Ga0451576_0116851 3300045051 Bacteria 2777
120 Ga0451576_0509752 3300045051 Unclassified 1264
121 Ga0495592_0000437 3300046454 Bacteria 31326
122 Ga0495618_0002995 3300046514 Bacteria 10675
123 Ga0495628_0000054 3300046516 Bacteria 90760
124 Ga0495628_0311674 3300046516 Bacteria 1163
125 Ga0495630_0023567 3300046517 Bacteria 4550
126 Ga0495640_0101101 3300046533 Bacteria 1892
127 Ga0495640_0167964 3300046533 Bacteria 1403
128 Ga0495586_0004329 3300046535 Bacteria 7585
129 Ga0495587_0253449 3300046536 Bacteria 989
130 Ga0495645_0022444 3300046543 Bacteria 4566
131 Ga0495667_0139142 3300046559 Bacteria 1565
132 Ga0495667_0201292 3300046559 Bacteria 1274
133 Ga0495634_0130849 3300046642 Bacteria 1600
134 Ga0495657_0099048 3300046675 Bacteria 1859
135 Ga0495658_0135326 3300046683 Bacteria 1503
136 Ga0495624_0056279 3300046690 Bacteria 2475
137 Ga0495674_0022609 3300047319 Bacteria 5797
138 Ga0496109_1307902 3300048912 Unclassified 661
139 Ga0496112_0319214 3300048915 Unclassified 1498
140 nmdc:mga08y16_496118_c1 3300050511 Bacteria 1241
141 nmdc:mga08x19_300795_c1 3300050514 Bacteria 1114
142 nmdc:mga0a205_319432_c1 3300050515 Unclassified 1424

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014968 Ga0157379_10789030 Ga0157379_107890302 182
2 3300044712 Ga0453684_1883178 Ga0453684_1883178_19_570 182
3 3300048912 Ga0496109_1307902 Ga0496109_1307902_72_620 182
4 3300028556 Ga0265337_1026381 Ga0265337_10263812 188
5 3300031240 Ga0265320_10000488 Ga0265320_1000048829 188
6 3300028556 Ga0265337_1011846 Ga0265337_10118463 199
7 3300028563 Ga0265319_1000003 Ga0265319_1000003267 199
8 3300031240 Ga0265320_10006148 Ga0265320_1000614810 199
9 3300031595 Ga0265313_10005395 Ga0265313_100053953 199
10 3300005617 Ga0068859_100408931 Ga0068859_1004089312 206
11 3300006931 Ga0097620_100408938 Ga0097620_1004089382 206
12 3300028800 Ga0265338_10002298 Ga0265338_1000229817 206
13 3300031251 Ga0265327_10009551 Ga0265327_100095515 206
14 3300031344 Ga0265316_10065572 Ga0265316_100655723 206
15 3300028800 Ga0265338_10242861 Ga0265338_102428612 208
16 3300009551 Ga0105238_10618989 Ga0105238_106189892 209
17 3300025924 Ga0207694_10469251 Ga0207694_104692512 209
18 3300028800 Ga0265338_10128234 Ga0265338_101282342 209
19 3300028556 Ga0265337_1001832 Ga0265337_10018328 210
20 3300028800 Ga0265338_10000494 Ga0265338_100004945 210
21 3300028800 Ga0265338_10077364 Ga0265338_100773644 211
22 3300028558 Ga0265326_10032329 Ga0265326_100323291 216
23 3300046516 Ga0495628_0311674 Ga0495628_0311674_482_1132 216
24 3300006846 Ga0075430_100035633 Ga0075430_1000356333 219
25 3300006871 Ga0075434_100266215 Ga0075434_1002662152 219
26 3300035695 Ga0373927_0001027 Ga0373927_0001027_8507_9166 219
27 3300050511 nmdc:mga08y16_496118_c1 nmdc:mga08y16_496118_c1_153_878 219
28 3300005535 Ga0070684_100275011 Ga0070684_1002750112 220
29 3300005539 Ga0068853_100352567 Ga0068853_1003525671 220
30 3300005563 Ga0068855_100346671 Ga0068855_1003466712 220
31 3300005614 Ga0068856_100046544 Ga0068856_1000465443 220
32 3300009093 Ga0105240_10270663 Ga0105240_102706632 220
33 3300009174 Ga0105241_10476046 Ga0105241_104760461 220
34 3300009551 Ga0105238_10066737 Ga0105238_100667374 220
35 3300013102 Ga0157371_10346980 Ga0157371_103469801 220
36 3300013297 Ga0157378_10397322 Ga0157378_103973222 220
37 3300026041 Ga0207639_10186480 Ga0207639_101864802 220
38 3300028800 Ga0265338_10028082 Ga0265338_100280823 220
39 3300031344 Ga0265316_10004185 Ga0265316_100041856 220
40 3300031711 Ga0265314_10053868 Ga0265314_100538684 220
41 3300005340 Ga0070689_100020536 Ga0070689_1000205363 221
42 3300005440 Ga0070705_100239420 Ga0070705_1002394202 221
43 3300005458 Ga0070681_10092829 Ga0070681_100928292 221
44 3300005458 Ga0070681_10598411 Ga0070681_105984111 221
45 3300005535 Ga0070684_100478566 Ga0070684_1004785662 221
46 3300005563 Ga0068855_100003834 Ga0068855_1000038348 221
47 3300005614 Ga0068856_100000573 Ga0068856_10000057343 221
48 3300005615 Ga0070702_100214500 Ga0070702_1002145002 221
49 3300005617 Ga0068859_100735248 Ga0068859_1007352483 221
50 3300005618 Ga0068864_100086731 Ga0068864_1000867312 221
51 3300005841 Ga0068863_100204085 Ga0068863_1002040852 221
52 3300005841 Ga0068863_100292232 Ga0068863_1002922322 221
53 3300006175 Ga0070712_100045227 Ga0070712_1000452274 221
54 3300006175 Ga0070712_100144360 Ga0070712_1001443603 221
55 3300006852 Ga0075433_10241543 Ga0075433_102415432 221
56 3300006914 Ga0075436_100266940 Ga0075436_1002669401 221
57 3300006931 Ga0097620_100735103 Ga0097620_1007351033 221
58 3300009177 Ga0105248_10576746 Ga0105248_105767462 221
59 3300009551 Ga0105238_10159836 Ga0105238_101598362 221
60 3300013297 Ga0157378_10071488 Ga0157378_100714884 221
61 3300013307 Ga0157372_10646873 Ga0157372_106468731 221
62 3300013308 Ga0157375_10026043 Ga0157375_100260434 221
63 3300014325 Ga0163163_10106343 Ga0163163_101063433 221
64 3300014969 Ga0157376_10986184 Ga0157376_109861841 221
65 3300025915 Ga0207693_10283308 Ga0207693_102833081 221
66 3300025936 Ga0207670_10007303 Ga0207670_100073034 221
67 3300025949 Ga0207667_10016208 Ga0207667_100162086 221
68 3300025949 Ga0207667_10106627 Ga0207667_101066272 221
69 3300026035 Ga0207703_10767760 Ga0207703_107677601 221
70 3300026078 Ga0207702_10000808 Ga0207702_1000080826 221
71 3300026088 Ga0207641_10442531 Ga0207641_104425312 221
72 3300026095 Ga0207676_10054571 Ga0207676_100545713 221
73 3300028556 Ga0265337_1013152 Ga0265337_10131522 221
74 3300028556 Ga0265337_1013515 Ga0265337_10135152 221
75 3300028556 Ga0265337_1036483 Ga0265337_10364832 221
76 3300028558 Ga0265326_10026026 Ga0265326_100260262 221
77 3300028563 Ga0265319_1010011 Ga0265319_10100114 221
78 3300028563 Ga0265319_1083908 Ga0265319_10839081 221
79 3300028653 Ga0265323_10000183 Ga0265323_1000018321 221
80 3300028653 Ga0265323_10010515 Ga0265323_100105153 221
81 3300028653 Ga0265323_10036192 Ga0265323_100361922 221
82 3300028653 Ga0265323_10050845 Ga0265323_100508452 221
83 3300028653 Ga0265323_10053363 Ga0265323_100533632 221
84 3300028654 Ga0265322_10007153 Ga0265322_100071532 221
85 3300028800 Ga0265338_10000184 Ga0265338_1000018494 221
86 3300028800 Ga0265338_10000701 Ga0265338_1000070155 221
87 3300028800 Ga0265338_10001733 Ga0265338_1000173312 221
88 3300028800 Ga0265338_10001968 Ga0265338_1000196813 221
89 3300028800 Ga0265338_10006014 Ga0265338_100060148 221
90 3300028800 Ga0265338_10028256 Ga0265338_100282564 221
91 3300028800 Ga0265338_10037676 Ga0265338_100376763 221
92 3300028800 Ga0265338_10043402 Ga0265338_100434022 221
93 3300028800 Ga0265338_10078715 Ga0265338_100787152 221
94 3300028800 Ga0265338_10087314 Ga0265338_100873141 221
95 3300028800 Ga0265338_10088615 Ga0265338_100886153 221
96 3300028800 Ga0265338_10105797 Ga0265338_101057973 221
97 3300028800 Ga0265338_10145034 Ga0265338_101450342 221
98 3300028800 Ga0265338_10193386 Ga0265338_101933862 221
99 3300029957 Ga0265324_10000058 Ga0265324_100000584 221
100 3300029957 Ga0265324_10017085 Ga0265324_100170853 221
101 3300031240 Ga0265320_10000296 Ga0265320_1000029621 221
102 3300031240 Ga0265320_10036694 Ga0265320_100366943 221
103 3300031240 Ga0265320_10053329 Ga0265320_100533292 221
104 3300031241 Ga0265325_10011888 Ga0265325_100118884 221
105 3300031247 Ga0265340_10000162 Ga0265340_100001625 221
106 3300031247 Ga0265340_10040301 Ga0265340_100403013 221
107 3300031247 Ga0265340_10044638 Ga0265340_100446382 221
108 3300031251 Ga0265327_10137673 Ga0265327_101376731 221
109 3300031344 Ga0265316_10010832 Ga0265316_100108326 221
110 3300031344 Ga0265316_10069412 Ga0265316_100694122 221
111 3300031344 Ga0265316_10069468 Ga0265316_100694682 221
112 3300031665 Ga0316575_10159752 Ga0316575_101597521 221
113 3300031711 Ga0265314_10039861 Ga0265314_100398614 221
114 3300031712 Ga0265342_10102209 Ga0265342_101022092 221
115 3300035086 Ga0373934_0086876 Ga0373934_0086876_557_1225 221
116 3300035118 Ga0373954_0022683 Ga0373954_0022683_1129_1797 221
117 3300036401 Ga0373937_0049034 Ga0373937_0049034_2389_3057 221
118 3300042876 Ga0451577_0029324 Ga0451577_0029324_1837_2559 221
119 3300044712 Ga0453684_0001011 Ga0453684_0001011_75503_76225 221
120 3300044712 Ga0453684_0008573 Ga0453684_0008573_4209_4886 221
121 3300045051 Ga0451576_0104817 Ga0451576_0104817_293_997 221
122 3300045051 Ga0451576_0116851 Ga0451576_0116851_1746_2426 221
123 3300045051 Ga0451576_0509752 Ga0451576_0509752_169_837 221
124 3300046454 Ga0495592_0000437 Ga0495592_0000437_2498_3235 221
125 3300046514 Ga0495618_0002995 Ga0495618_0002995_1481_2218 221
126 3300046516 Ga0495628_0000054 Ga0495628_0000054_76127_76864 221
127 3300046517 Ga0495630_0023567 Ga0495630_0023567_2268_3005 221
128 3300046533 Ga0495640_0101101 Ga0495640_0101101_578_1315 221
129 3300046533 Ga0495640_0167964 Ga0495640_0167964_500_1207 221
130 3300046535 Ga0495586_0004329 Ga0495586_0004329_2887_3624 221
131 3300046536 Ga0495587_0253449 Ga0495587_0253449_185_922 221
132 3300046543 Ga0495645_0022444 Ga0495645_0022444_319_1056 221
133 3300046559 Ga0495667_0139142 Ga0495667_0139142_177_914 221
134 3300046559 Ga0495667_0201292 Ga0495667_0201292_111_818 221
135 3300046642 Ga0495634_0130849 Ga0495634_0130849_324_1031 221
136 3300046675 Ga0495657_0099048 Ga0495657_0099048_1063_1731 221
137 3300046683 Ga0495658_0135326 Ga0495658_0135326_273_1010 221
138 3300046690 Ga0495624_0056279 Ga0495624_0056279_726_1463 221
139 3300047319 Ga0495674_0022609 Ga0495674_0022609_3092_3829 221
140 3300048915 Ga0496112_0319214 Ga0496112_0319214_813_1481 221
141 3300050514 nmdc:mga08x19_300795_c1 nmdc:mga08x19_300795_c1_63_731 221
142 3300050515 nmdc:mga0a205_319432_c1 nmdc:mga0a205_319432_c1_648_1340 221

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02517

Rce1-like

Type II CAAX prenyl endopeptidase Rce1-like

128

233

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cad-assembly4.cif.gz_L mechanism of farnesylated caax protein processing by the integral membrane protease rce1 0.4246 10 221
4cad-assembly4.cif.gz_L mechanism of farnesylated caax protein processing by the integral membrane protease rce1 0.4111 10 221
4ny3-assembly2.cif.gz_B human ptpa in complex with peptide 0.2847 63 220
2m5b-assembly1.cif.gz_A the nmr structure of the bid-bak complex 0.2822 70 219
3mk8-assembly1.cif.gz_A the mcl-1 bh3 helix is an exclusive mcl-1 inhibitor and apoptosis sensitizer 0.2806 69 218
ID Description Score Start End Superfamily
af_Q2RB46_272_432_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3461 12 219 1.20.1250.20
af_A0A0R0EVP9_174_336_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3438 12 219 1.20.1250.20
af_P38124_101_531_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3286 51 210 1.20.1250.20
af_Q6P9T9_32_232_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3112 2 206 1.20.1250.20
af_Q2RB46_272_432_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3057 12 219 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3C1V916-F1-model_v4 CAAX prenyl protease-related protein 1 108 221 GO:0004222
GO:0016020
GO:0071586
AF-A0A3C1V916-F1-model_v4 CAAX prenyl protease-related protein 0.9914 108 221 GO:0004222
GO:0016020
GO:0071586
AF-A0A3M1I8W4-F1-model_v4 CAAX prenyl protease-related protein 0.9871 2 221 GO:0004222
GO:0016020
GO:0071586
AF-A0A1W7QPU6-F1-model_v4 deleted 0.9856 130 221
AF-A0A7C7RH18-F1-model_v4 CAAX prenyl protease-related protein 0.9835 107 221 GO:0004222
GO:0016020
GO:0071586

Feature Viewer

pLDDT pTM Quality
94.18 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map