F185455

General Info

Members Datasets Scaffolds Average Seq Length
142 95 284 263

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100000784|Ga0075436_1000007847
Length 287
Sequence MTEVPAAARASSRYAREITAAILSPVAIWIIGWAPNPVFDAVIGLIASLALYEFLVLGRRKGFHIPIAICIAAMLFIVAAFILEPISVEMGVFLTLLVIPGTYIFSNGSLDDALPSSGIAVLATLYVGMLGGSLVRLHNDFAEGPKLIFFLVLVVWLGDAGAYYCGKTFGRHKMSPRISPKKTVEGGIGGAATSVITAVVCHFTFFKAFPLLHAIIAGVILSISGMIGDLAESMWKRSAAVKDSGTLIPGHGGFLDRFDSIFYTAPILYSYWFLIVHNFESFKIMSA

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
84 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
85 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
86 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
87 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
88 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
89 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
90 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
91 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
92 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
93 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
94 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
95 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 93.66
Stem 0
Stem Tuber 0
Unclassified 3.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100000784 3300006914 Bacteria 21081
2 Ga0065715_10334033 3300005293 Unclassified 978
3 Ga0065707_10144998 3300005295 Bacteria 1725
4 Ga0070683_100000069 3300005329 Bacteria 72902
5 Ga0070670_100000286 3300005331 Bacteria 44481
6 Ga0068869_100169762 3300005334 Bacteria 1703
7 Ga0070682_100000136 3300005337 Bacteria 60325
8 Ga0070682_100177738 3300005337 Bacteria 1484
9 Ga0068868_100000317 3300005338 Bacteria 32390
10 Ga0068868_100001051 3300005338 Bacteria 18880
11 Ga0070687_100017293 3300005343 Bacteria 3312
12 Ga0070692_10012078 3300005345 Bacteria 3985
13 Ga0070675_100000023 3300005354 Bacteria 122380
14 Ga0070674_100198966 3300005356 Bacteria 1546
15 Ga0070714_100201658 3300005435 Bacteria 1820
16 Ga0070713_100122042 3300005436 Bacteria 2287
17 Ga0070700_100000163 3300005441 Bacteria 38495
18 Ga0070708_100025018 3300005445 Bacteria 5101
19 Ga0070708_100026114 3300005445 Bacteria 4997
20 Ga0070678_100173761 3300005456 Bacteria 1757
21 Ga0070678_100243491 3300005456 Bacteria 1505
22 Ga0070706_100011107 3300005467 Bacteria 8363
23 Ga0070706_100358044 3300005467 Bacteria 1360
24 Ga0070707_100005183 3300005468 Bacteria 12210
25 Ga0070707_100013467 3300005468 Bacteria 7652
26 Ga0070707_100072074 3300005468 Bacteria 3329
27 Ga0070698_100027094 3300005471 Bacteria 5960
28 Ga0070698_100189085 3300005471 Bacteria 1997
29 Ga0070699_100012362 3300005518 Bacteria 7365
30 Ga0070699_100029316 3300005518 Bacteria 4745
31 Ga0070684_100000529 3300005535 Bacteria 26178
32 Ga0070697_100036083 3300005536 Bacteria 3992
33 Ga0068853_100114269 3300005539 Bacteria 2401
34 Ga0068853_100382102 3300005539 Bacteria 1315
35 Ga0070672_100000054 3300005543 Bacteria 50993
36 Ga0070672_100061937 3300005543 Bacteria 2951
37 Ga0068857_100029268 3300005577 Bacteria 4861
38 Ga0068854_100008181 3300005578 Bacteria 6708
39 Ga0068854_100042537 3300005578 Bacteria 3216
40 Ga0070702_100228799 3300005615 Bacteria 1248
41 Ga0068864_100000009 3300005618 Bacteria 373756
42 Ga0068858_100010311 3300005842 Bacteria 8855
43 Ga0068860_100000993 3300005843 Bacteria 31385
44 Ga0070717_10000406 3300006028 Bacteria 27593
45 Ga0070717_10268718 3300006028 Unclassified 1510
46 Ga0070716_100259157 3300006173 Bacteria 1189
47 Ga0068871_100153328 3300006358 Bacteria 1966
48 Ga0075428_100000463 3300006844 Bacteria 40820
49 Ga0075434_100470576 3300006871 Bacteria 1278
50 Ga0075435_100000228 3300007076 Bacteria 34304
51 Ga0075435_100116491 3300007076 Bacteria 2226
52 Ga0105240_10016262 3300009093 Bacteria 10079
53 Ga0105245_10000003 3300009098 Bacteria 488207
54 Ga0105245_10000457 3300009098 Bacteria 37366
55 Ga0105245_10001241 3300009098 Bacteria 23017
56 Ga0105245_10205602 3300009098 Bacteria 1893
57 Ga0114129_10063594 3300009147 Bacteria 5152
58 Ga0114129_10690335 3300009147 Bacteria 1313
59 Ga0105242_10003189 3300009176 Bacteria 12785
60 Ga0105238_10000005 3300009551 Bacteria 372840
61 Ga0105239_10053061 3300010375 Bacteria 4448
62 Ga0105246_10030875 3300011119 Bacteria 3542
63 Ga0157369_10001191 3300013105 Bacteria 32458
64 Ga0157374_10000006 3300013296 Bacteria 640284
65 Ga0157374_10438371 3300013296 Bacteria 1307
66 Ga0157378_10000751 3300013297 Bacteria 30334
67 Ga0157378_10001935 3300013297 Bacteria 18574
68 Ga0157378_10030903 3300013297 Bacteria 4729
69 Ga0157378_10220390 3300013297 Bacteria 1803
70 Ga0163162_10027010 3300013306 Bacteria 5677
71 Ga0157375_10000011 3300013308 Bacteria 334557
72 Ga0157375_10000047 3300013308 Bacteria 141526
73 Ga0157375_10000841 3300013308 Bacteria 26848
74 Ga0157380_10006282 3300014326 Bacteria 8343
75 Ga0157377_10000003 3300014745 Bacteria 435133
76 Ga0157377_10000099 3300014745 Bacteria 61280
77 Ga0157376_10000150 3300014969 Bacteria 47766
78 Ga0213873_10000004 3300021358 Bacteria 774374
79 Ga0213873_10006828 3300021358 Bacteria 2261
80 Ga0213876_10000007 3300021384 Bacteria 670340
81 Ga0213876_10000623 3300021384 Bacteria 25985
82 Ga0213876_10013205 3300021384 Bacteria 4389
83 Ga0207699_10127652 3300025906 Bacteria 1654
84 Ga0207643_10031594 3300025908 Bacteria 2952
85 Ga0207684_10005625 3300025910 Bacteria 11521
86 Ga0207695_10017649 3300025913 Bacteria 8291
87 Ga0207662_10031581 3300025918 Bacteria 3077
88 Ga0207646_10002952 3300025922 Bacteria 19689
89 Ga0207646_10031096 3300025922 Bacteria 4834
90 Ga0207646_10327218 3300025922 Bacteria 1385
91 Ga0207646_10388399 3300025922 Bacteria 1261
92 Ga0207694_10000001 3300025924 Bacteria 4078485
93 Ga0207650_10000146 3300025925 Bacteria 85536
94 Ga0207659_10000009 3300025926 Bacteria 308304
95 Ga0207687_10000002 3300025927 Bacteria 975489
96 Ga0207687_10001464 3300025927 Bacteria 16200
97 Ga0207687_10054546 3300025927 Bacteria 2797
98 Ga0207700_10052250 3300025928 Bacteria 3054
99 Ga0207686_10028486 3300025934 Bacteria 3284
100 Ga0207669_10200523 3300025937 Bacteria 1448
101 Ga0207669_10240778 3300025937 Bacteria 1341
102 Ga0207665_10235973 3300025939 Unclassified 1346
103 Ga0207691_10000102 3300025940 Bacteria 75317
104 Ga0207689_10023539 3300025942 Bacteria 5168
105 Ga0207661_10000013 3300025944 Bacteria 348811
106 Ga0207661_10383236 3300025944 Bacteria 1273
107 Ga0207640_10002007 3300025981 Bacteria 10991
108 Ga0207640_10197595 3300025981 Bacteria 1521
109 Ga0207677_10000065 3300026023 Bacteria 88193
110 Ga0207677_10000081 3300026023 Bacteria 78954
111 Ga0207703_10000215 3300026035 Bacteria 67474
112 Ga0207703_10174204 3300026035 Bacteria 1895
113 Ga0207639_10000084 3300026041 Bacteria 80748
114 Ga0207639_10319612 3300026041 Bacteria 1378
115 Ga0207639_10429725 3300026041 Bacteria 1196
116 Ga0207708_10000010 3300026075 Bacteria 227178
117 Ga0207648_10100141 3300026089 Bacteria 2538
118 Ga0207676_10000007 3300026095 Bacteria 591074
119 Ga0207674_10004083 3300026116 Bacteria 17688
120 Ga0207683_10264032 3300026121 Bacteria 1572
121 Ga0207698_10655125 3300026142 Unclassified 1041
122 Ga0268264_10000883 3300028381 Bacteria 31611
123 Ga0307511_10049848 3300030521 Bacteria 3381
124 Ga0373943_0117662 3300035170 Bacteria 1409
125 Ga0436365_0311259 3300039437 Bacteria 72483
126 Ga0436365_0356160 3300039437 Bacteria 2457
127 Ga0436365_1391222 3300039437 Bacteria 77176
128 Ga0436365_1815404 3300039437 Bacteria 22158
129 Ga0436362_0290430 3300039453 Bacteria 772596
130 Ga0436362_0496230 3300039453 Bacteria 6056
131 Ga0451853_1920184 3300041512 Bacteria 1321
132 Ga0495620_0001261 3300046515 Bacteria 15445
133 Ga0495679_015410 3300047446 Bacteria 2797
134 Ga0501073_0076714 3300049589 Unclassified 2325
135 nmdc:mga05p37_157220_c1 3300050507 Bacteria 2777
136 nmdc:mga0n895_283915_c1 3300050512 Bacteria 1678
137 nmdc:mga0n895_543321_c1 3300050512 Bacteria 1168
138 nmdc:mga0rr50_118_c1 3300050513 Bacteria 43526
139 nmdc:mga0rr50_2355_c1 3300050513 Bacteria 10634
140 nmdc:mga0rr50_48944_c1 3300050513 Bacteria 3127
141 nmdc:mga08x19_292_c1 3300050514 Bacteria 36844
142 Ga0495655_0000387 3300053083 Bacteria 7536
143 Ga0075436_100000784
144 Ga0065715_10334033
145 Ga0065707_10144998
146 Ga0070683_100000069
147 Ga0070670_100000286
148 Ga0068869_100169762
149 Ga0070682_100000136
150 Ga0070682_100177738
151 Ga0068868_100000317
152 Ga0068868_100001051
153 Ga0070687_100017293
154 Ga0070692_10012078
155 Ga0070675_100000023
156 Ga0070674_100198966
157 Ga0070714_100201658
158 Ga0070713_100122042
159 Ga0070700_100000163
160 Ga0070708_100025018
161 Ga0070708_100026114
162 Ga0070678_100173761
163 Ga0070678_100243491
164 Ga0070706_100011107
165 Ga0070706_100358044
166 Ga0070707_100005183
167 Ga0070707_100013467
168 Ga0070707_100072074
169 Ga0070698_100027094
170 Ga0070698_100189085
171 Ga0070699_100012362
172 Ga0070699_100029316
173 Ga0070684_100000529
174 Ga0070697_100036083
175 Ga0068853_100114269
176 Ga0068853_100382102
177 Ga0070672_100000054
178 Ga0070672_100061937
179 Ga0068857_100029268
180 Ga0068854_100008181
181 Ga0068854_100042537
182 Ga0070702_100228799
183 Ga0068864_100000009
184 Ga0068858_100010311
185 Ga0068860_100000993
186 Ga0070717_10000406
187 Ga0070717_10268718
188 Ga0070716_100259157
189 Ga0068871_100153328
190 Ga0075428_100000463
191 Ga0075434_100470576
192 Ga0075435_100000228
193 Ga0075435_100116491
194 Ga0105240_10016262
195 Ga0105245_10000003
196 Ga0105245_10000457
197 Ga0105245_10001241
198 Ga0105245_10205602
199 Ga0114129_10063594
200 Ga0114129_10690335
201 Ga0105242_10003189
202 Ga0105238_10000005
203 Ga0105239_10053061
204 Ga0105246_10030875
205 Ga0157369_10001191
206 Ga0157374_10000006
207 Ga0157374_10438371
208 Ga0157378_10000751
209 Ga0157378_10001935
210 Ga0157378_10030903
211 Ga0157378_10220390
212 Ga0163162_10027010
213 Ga0157375_10000011
214 Ga0157375_10000047
215 Ga0157375_10000841
216 Ga0157380_10006282
217 Ga0157377_10000003
218 Ga0157377_10000099
219 Ga0157376_10000150
220 Ga0213873_10000004
221 Ga0213873_10006828
222 Ga0213876_10000007
223 Ga0213876_10000623
224 Ga0213876_10013205
225 Ga0207699_10127652
226 Ga0207643_10031594
227 Ga0207684_10005625
228 Ga0207695_10017649
229 Ga0207662_10031581
230 Ga0207646_10002952
231 Ga0207646_10031096
232 Ga0207646_10327218
233 Ga0207646_10388399
234 Ga0207694_10000001
235 Ga0207650_10000146
236 Ga0207659_10000009
237 Ga0207687_10000002
238 Ga0207687_10001464
239 Ga0207687_10054546
240 Ga0207700_10052250
241 Ga0207686_10028486
242 Ga0207669_10200523
243 Ga0207669_10240778
244 Ga0207665_10235973
245 Ga0207691_10000102
246 Ga0207689_10023539
247 Ga0207661_10000013
248 Ga0207661_10383236
249 Ga0207640_10002007
250 Ga0207640_10197595
251 Ga0207677_10000065
252 Ga0207677_10000081
253 Ga0207703_10000215
254 Ga0207703_10174204
255 Ga0207639_10000084
256 Ga0207639_10319612
257 Ga0207639_10429725
258 Ga0207708_10000010
259 Ga0207648_10100141
260 Ga0207676_10000007
261 Ga0207674_10004083
262 Ga0207683_10264032
263 Ga0207698_10655125
264 Ga0268264_10000883
265 Ga0307511_10049848
266 Ga0373943_0117662
267 Ga0436365_0311259
268 Ga0436365_0356160
269 Ga0436365_1391222
270 Ga0436365_1815404
271 Ga0436362_0290430
272 Ga0436362_0496230
273 Ga0451853_1920184
274 Ga0495620_0001261
275 Ga0495679_015410
276 Ga0501073_0076714
277 nmdc:mga05p37_157220_c1
278 nmdc:mga0n895_283915_c1
279 nmdc:mga0n895_543321_c1
280 nmdc:mga0rr50_118_c1
281 nmdc:mga0rr50_2355_c1
282 nmdc:mga0rr50_48944_c1
283 nmdc:mga08x19_292_c1
284 Ga0495655_0000387

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01148

CTP_transf_1

Cytidylyltransferase family

14

275

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q2g-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s223c, inactive mutant) 0.8175 8 244
4q2e-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) 0.8151 8 244
4q2g-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s223c, inactive mutant) 0.7642 8 244
4q2e-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) 0.7621 8 244
4tl3-assembly1.cif.gz_A mechanistic insights from the crystal structure of an inward proton-transporting anabaena sensory rhodopsin mutant 0.2541 25 248
ID Description Score Start End Superfamily
af_Q568Y5_1_114_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.311 34 160 1.20.5.110
af_A4HTX4_43_271_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3001 29 251 1.20.1250.20
af_A0A0G2K058_37_502_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2984 2 248 1.20.1250.20
af_Q568Y5_1_114_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.2827 34 160 1.20.5.110
af_G5EBM4_4_420_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2825 16 161 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2V7YJ26-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) (CDP-DAG synthase) (CDP-DG synthase) (CDP-diacylglycerol synthase) (CDP-diglyceride pyrophosphorylase) (CDP-diglyceride synthase) (CTP:phosphatidate cytidylyltransferase) 0.9046 1 254 GO:0004605
GO:0005886
GO:0016024
AF-A0A532UHE1-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) (CDP-DAG synthase) (CDP-DG synthase) (CDP-diacylglycerol synthase) (CDP-diglyceride pyrophosphorylase) (CDP-diglyceride synthase) (CTP:phosphatidate cytidylyltransferase) 0.9019 5 244 GO:0004605
GO:0005886
GO:0016024
AF-A0A2V7YJ26-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) (CDP-DAG synthase) (CDP-DG synthase) (CDP-diacylglycerol synthase) (CDP-diglyceride pyrophosphorylase) (CDP-diglyceride synthase) (CTP:phosphatidate cytidylyltransferase) 0.9012 1 254 GO:0004605
GO:0005886
GO:0016024
AF-A0A2V9JMI4-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.886 4 247 GO:0004605
GO:0005886
GO:0016024
AF-A0A7C7MZ87-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.8857 4 241 GO:0004605
GO:0005886
GO:0016024

Map